NS1-BP Antibody

Images

 
Western Blot: NS1-BP Antibody [NBP1-83180] - Analysis in control (vector only transfected HEK293T lysate) and IVNS1ABP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: NS1-BP Antibody [NBP1-83180] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NS1-BP Antibody [NBP1-83180] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Western Blot: NS1-BP Antibody [NBP1-83180] - Analysis in human cell lines U-251MG and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NS1-BP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSD
Specificity
Specificity of human NS1-BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IVNS1ABP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
NS1-BP Knockout HeLa Cell Lysate
Control Peptide
NS1-BP Protein (NBP1-83180PEP)
Publications
Read Publication using NBP1-83180.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23908247).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NS1-BP Antibody

  • ARA3
  • aryl hydrocarbon receptor-associated 3
  • Aryl hydrocarbon receptor-associated protein 3
  • DKFZp686K06216
  • FLARA3
  • FLJ10962
  • FLJ35593
  • FLJ36593
  • HSPC068
  • influenza virus NS1A binding protein
  • influenza virus NS1A-binding protein
  • KIAA0850FLJ10069
  • KLHL39
  • NCX downstream gene 1
  • ND1
  • NS1
  • NS-1
  • NS1-binding protein
  • NS1BP
  • NS1-BPFLJ10411

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47365
Species: Hu
Applications: WB, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-88937
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16904
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP3-05604
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-94464
Species: Hu, Mu, Rt
Applications: WB
NBP1-87466
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-79833
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-93832
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NS1-BP Antibody (NBP1-83180)(1)

Reviews for NS1-BP Antibody (NBP1-83180) (0)

There are no reviews for NS1-BP Antibody (NBP1-83180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NS1-BP Antibody (NBP1-83180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NS1-BP Products

Bioinformatics Tool for NS1-BP Antibody (NBP1-83180)

Discover related pathways, diseases and genes to NS1-BP Antibody (NBP1-83180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NS1-BP Antibody (NBP1-83180)

Discover more about diseases related to NS1-BP Antibody (NBP1-83180).
 

Pathways for NS1-BP Antibody (NBP1-83180)

View related products by pathway.

Blogs on NS1-BP

There are no specific blogs for NS1-BP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NS1-BP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IVNS1ABP