htrA4 Antibody


Immunohistochemistry-Paraffin: htrA4 Antibody [NBP2-30882] - Staining of human placenta shows high expression.
Immunohistochemistry: htrA4 Antibody [NBP2-30882] - Staining of human fallopian tube shows distinct membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: htrA4 Antibody [NBP2-30882] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: htrA4 Antibody [NBP2-30882] - Staining in human placenta and pancreas tissues using anti-HTRA4 antibody. Corresponding HTRA4 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

htrA4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: FAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSG
Specificity of human htrA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
htrA4 Protein (NBP2-30882PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for htrA4 Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC
  • FLJ90724
  • HtrA serine peptidase 4
  • probable serine protease HTRA4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, B/N, IHC-Fr, IHC-P, In vitro
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for htrA4 Antibody (NBP2-30882) (0)

There are no publications for htrA4 Antibody (NBP2-30882).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for htrA4 Antibody (NBP2-30882) (0)

There are no reviews for htrA4 Antibody (NBP2-30882). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for htrA4 Antibody (NBP2-30882) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional htrA4 Products

Bioinformatics Tool for htrA4 Antibody (NBP2-30882)

Discover related pathways, diseases and genes to htrA4 Antibody (NBP2-30882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for htrA4 Antibody (NBP2-30882)

Discover more about diseases related to htrA4 Antibody (NBP2-30882).

Pathways for htrA4 Antibody (NBP2-30882)

View related products by pathway.

PTMs for htrA4 Antibody (NBP2-30882)

Learn more about PTMs related to htrA4 Antibody (NBP2-30882).

Blogs on htrA4

There are no specific blogs for htrA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our htrA4 Antibody and receive a gift card or discount.


Gene Symbol HTRA4