ATP6V0A4 Antibody

Images

 
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human colon.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human lymph node shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining in human kidney and lymph node tissues using anti-ATP6V0A4 antibody. Corresponding ATP6V0A4 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human cerebral cortex, colon, kidney and liver using Anti-ATP6V0A4 antibody NBP1-89330 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V0A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS
Specificity
Specificity of human ATP6V0A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V0A4 Antibody

  • A4
  • ATP6N2
  • ATP6V0
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD)
  • ATPase, H+ transporting, lysosomal V0 subunit a4
  • MGC130016
  • MGC130017
  • noncatalytic accessory protein 1B
  • RDRTA2
  • RTA1C
  • RTADR
  • STV1
  • vacuolar proton pump 116 kDa accessory subunit
  • vacuolar proton pump, subunit 2
  • vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform
  • V-ATPase 116 kDa
  • VPH1
  • VPP2
  • V-type proton ATPase 116 kDa subunit a isoform 4
  • V-type proton ATPase 116 kDa subunit a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Ye, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, ChIP, IHC, IHC-Fr, IHC-P, IP
NBL1-11228
Species: Hu
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6457
Species: Hu
Applications: WB
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-45946
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90297
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-47829
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF

Publications for ATP6V0A4 Antibody (NBP1-89330) (0)

There are no publications for ATP6V0A4 Antibody (NBP1-89330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0A4 Antibody (NBP1-89330) (0)

There are no reviews for ATP6V0A4 Antibody (NBP1-89330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP6V0A4 Antibody (NBP1-89330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0A4