ATP6V0A4 Antibody


Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human colon.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human lymph node shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining in human kidney and lymph node tissues using anti-ATP6V0A4 antibody. Corresponding ATP6V0A4 RNA-seq data are more
Independent Antibodies: Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human cerebral cortex, colon, kidney and liver using Anti-ATP6V0A4 antibody NBP1-89330 (A) shows similar protein more
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human liver.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ATP6V0A4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS
Specificity of human ATP6V0A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V0A4 Recombinant Protein Antigen (NBP1-89330PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATP6V0A4 Antibody

  • A4
  • ATP6N2
  • ATP6V0
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD)
  • ATPase, H+ transporting, lysosomal V0 subunit a4
  • MGC130016
  • MGC130017
  • noncatalytic accessory protein 1B
  • RDRTA2
  • RTA1C
  • STV1
  • vacuolar proton pump 116 kDa accessory subunit
  • vacuolar proton pump, subunit 2
  • vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform
  • V-ATPase 116 kDa
  • VPH1
  • VPP2
  • V-type proton ATPase 116 kDa subunit a isoform 4
  • V-type proton ATPase 116 kDa subunit a


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF

Publications for ATP6V0A4 Antibody (NBP1-89330) (0)

There are no publications for ATP6V0A4 Antibody (NBP1-89330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0A4 Antibody (NBP1-89330) (0)

There are no reviews for ATP6V0A4 Antibody (NBP1-89330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP6V0A4 Antibody (NBP1-89330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP6V0A4 Antibody and receive a gift card or discount.


Gene Symbol ATP6V0A4