Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF, IHC |
Clone | 2E11 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA* |
Specificity | GCM1 - glial cells missing homolog 1 (Drosophila) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | GCM1 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against cell lysate for WB. It has been used for IF, IHC-P and ELISA. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00008521-M05 | Applications | Species |
---|---|---|
Hua Z, Bo P, Christian K et al. NPFF Increases Fusogenic Proteins Syncytin 1 and Syncytin 2 via GCM1 in First Trimester Primary Human Cytotrophoblast Cells. FASEB J. 2020-06-05 [PMID: 32501590] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.