HTRA1/PRSS11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HTRA1/PRSS11 Antibody [NBP1-81654] - Staining of human cell line LHCN-M2 shows localization to plasma membrane. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HTRA1/PRSS11 Antibody [NBP1-81654] - Staining in human cervix, uterine and testis tissues using anti-HTRA1 antibody. Corresponding HTRA1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: HTRA1/PRSS11 Antibody [NBP1-81654] - Staining of human cervix, uterine shows high expression.
Immunohistochemistry-Paraffin: HTRA1/PRSS11 Antibody [NBP1-81654] - Staining of human testis shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HTRA1/PRSS11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIA
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTRA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HTRA1/PRSS11 Protein (NBP1-81654PEP)
Publications
Read Publication using NBP1-81654.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HTRA1/PRSS11 Antibody

  • ARMD7
  • EC 3.4.21
  • EC 3.4.21.108
  • High-temperature requirement A serine peptidase 1
  • HtrA serine peptidase 1
  • HTRA1
  • IGFBP5-protease
  • L56
  • ORF480
  • PRSS11
  • Serine protease 11
  • serine, 11 (IGF binding)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4779
Species: Hu
Applications: WB, IHC
NBP1-07010
Species: Hu, Rt, Pm
Applications: WB, ELISA, ICC/IF
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1151
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73857
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP2-92674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-75341
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-94035
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-86967
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
H00004854-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for HTRA1/PRSS11 Antibody (NBP1-81654)(1)

Reviews for HTRA1/PRSS11 Antibody (NBP1-81654) (0)

There are no reviews for HTRA1/PRSS11 Antibody (NBP1-81654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HTRA1/PRSS11 Antibody (NBP1-81654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HTRA1/PRSS11 Products

Bioinformatics Tool for HTRA1/PRSS11 Antibody (NBP1-81654)

Discover related pathways, diseases and genes to HTRA1/PRSS11 Antibody (NBP1-81654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HTRA1/PRSS11 Antibody (NBP1-81654)

Discover more about diseases related to HTRA1/PRSS11 Antibody (NBP1-81654).
 

Pathways for HTRA1/PRSS11 Antibody (NBP1-81654)

View related products by pathway.

PTMs for HTRA1/PRSS11 Antibody (NBP1-81654)

Learn more about PTMs related to HTRA1/PRSS11 Antibody (NBP1-81654).

Blogs on HTRA1/PRSS11

There are no specific blogs for HTRA1/PRSS11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HTRA1/PRSS11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTRA1