AMD1 Antibody

Images

 
Western Blot: AMD1 Antibody [NBP1-87094] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: AMD1 Antibody [NBP1-87094] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: AMD1 Antibody [NBP1-87094] - Staining of human placenta shows distinct nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AMD1 Protein (NBP1-87094PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AMD1 Antibody

  • adenosylmethionine decarboxylase 1
  • AdoMetDC
  • AMD
  • DKFZp313L1234
  • EC 4.1.1.50
  • S-adenosylmethionine decarboxylase 1
  • S-adenosylmethionine decarboxylase proenzyme
  • SAMDCFLJ26964

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1936
Species: Hu
Applications: WB, IP
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-15447
Species: Hu
Applications: WB
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP1-80726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87094
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AMD1 Antibody (NBP1-87094) (0)

There are no publications for AMD1 Antibody (NBP1-87094).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMD1 Antibody (NBP1-87094) (0)

There are no reviews for AMD1 Antibody (NBP1-87094). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMD1 Antibody (NBP1-87094) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMD1 Products

Bioinformatics Tool for AMD1 Antibody (NBP1-87094)

Discover related pathways, diseases and genes to AMD1 Antibody (NBP1-87094). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMD1 Antibody (NBP1-87094)

Discover more about diseases related to AMD1 Antibody (NBP1-87094).
 

Pathways for AMD1 Antibody (NBP1-87094)

View related products by pathway.

PTMs for AMD1 Antibody (NBP1-87094)

Learn more about PTMs related to AMD1 Antibody (NBP1-87094).
 

Research Areas for AMD1 Antibody (NBP1-87094)

Find related products by research area.

Blogs on AMD1

There are no specific blogs for AMD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMD1