HspA6 Antibody

Images

 
Western Blot: HspA6 Antibody [NBP1-85949] - Analysis in human plasma.
Immunohistochemistry-Paraffin: HspA6 Antibody [NBP1-85949] - Staining of human Skin shows moderate nuclear and cytoplasmic positivity in squamous epithelial cells.
Western Blot: HspA6 Antibody [NBP1-85949] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: HspA6 Antibody [NBP1-85949] - Lane 1: Protein Marker [kDa], Lanes 2 and 3: Porcine endometrium. 40 ug of tissue lysate separated in 4-20% SDS gel and immunoblotted with primary antibody diluted 1:1000. ...read more
Immunohistochemistry-Paraffin: HspA6 Antibody [NBP1-85949] - Staining of human Cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: HspA6 Antibody [NBP1-85949] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: HspA6 Antibody [NBP1-85949] - Staining of human Testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HspA6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HspA6 Protein (NBP1-85949PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85949 in the following applications:

Reactivity Notes

Reported reactivity in Porcine from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HspA6 Antibody

  • heat shock 70 kDa protein 6
  • Heat shock 70 kDa protein B'
  • heat shock 70kD protein 6 (HSP70B')
  • heat shock 70kDa protein 6 (HSP70B')
  • HSP70B'

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DYC1663-2
Species: Hu, Mu, Rt
Applications: ELISA
H00003304-M02
Species: Bv, Hu, Mu, Po, Rt
Applications: DB, ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP1-33022
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-75477
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-86185
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-88019
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-67455
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85949
Species: Hu, Po
Applications: WB, IHC, IHC-P

Publications for HspA6 Antibody (NBP1-85949) (0)

There are no publications for HspA6 Antibody (NBP1-85949).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for HspA6 Antibody (NBP1-85949) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Porcine.

Reviews using NBP1-85949:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Porcine
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot HspA6 NBP1-85949
Enlarge
5
reviewed by:
Verified Customer
Western Blot Porcine 09/11/2018
View

Summary

ApplicationWestern Blot
Sample TestedPorcine endometrium
SpeciesPorcine
LotA106785

Comments

CommentsWestern Blot: HspA6 Antibody [NBP1-85949]
Lane 1: Protein Marker [kDa] Lanes 2 and 3: Porcine endometrium ; 40ug of tissue lysate separated in 4-20% SDS gel and immunoblotted with primary antibody diluted @ 1:1000.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HspA6 Antibody (NBP1-85949) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HspA6 Products

Bioinformatics Tool for HspA6 Antibody (NBP1-85949)

Discover related pathways, diseases and genes to HspA6 Antibody (NBP1-85949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HspA6 Antibody (NBP1-85949)

Discover more about diseases related to HspA6 Antibody (NBP1-85949).
 

Pathways for HspA6 Antibody (NBP1-85949)

View related products by pathway.

PTMs for HspA6 Antibody (NBP1-85949)

Learn more about PTMs related to HspA6 Antibody (NBP1-85949).

Blogs on HspA6

There are no specific blogs for HspA6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
09/11/2018
Application: Western Blot
Species: Porcine

Bioinformatics

Gene Symbol HSPA6