HSD3B7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HSD3B7 Antibody [NBP2-56368] - Staining of human cell line Hep G2 shows localization to lipid droplets.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSD3B7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ
Specificity
Specificity of human HSD3B7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD3B7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSD3B7 Recombinant Protein Antigen (NBP2-56368PEP)

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HSD3B7 Antibody

  • 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase
  • 3 beta-hydroxysteroid dehydrogenase type 7
  • 3 beta-hydroxysteroid dehydrogenase type VII
  • 3-beta-HSD VII
  • 7-alpha-diol 3-beta-dehydrogenase
  • C(27) 3-beta-HSD
  • C(27)-3BETA-HSD
  • Cholest-5-ene-3-beta
  • EC 1.1.1.-
  • EC 1.1.1.181
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase
  • PFIC4
  • SDR11E3
  • short chain dehydrogenase/reductase family 11E, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-78644
Species: Hu, Rt, Po, Pm, Bv, Gt, Pm, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27352
Species: Hu, Pm, Pm
Applications: WB, IHC, IHC-P
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-32353
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB
AF5510
Species: Hu
Applications: WB
NBP1-86182
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4027
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NB100-75341
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA
NBP1-56484
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-51911
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA, ChIP
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC

Publications for HSD3B7 Antibody (NBP2-56368) (0)

There are no publications for HSD3B7 Antibody (NBP2-56368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD3B7 Antibody (NBP2-56368) (0)

There are no reviews for HSD3B7 Antibody (NBP2-56368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HSD3B7 Antibody (NBP2-56368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSD3B7 Products

Bioinformatics Tool for HSD3B7 Antibody (NBP2-56368)

Discover related pathways, diseases and genes to HSD3B7 Antibody (NBP2-56368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD3B7 Antibody (NBP2-56368)

Discover more about diseases related to HSD3B7 Antibody (NBP2-56368).
 

Pathways for HSD3B7 Antibody (NBP2-56368)

View related products by pathway.

Blogs on HSD3B7

There are no specific blogs for HSD3B7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD3B7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD3B7