PYGL Antibody

Images

 
Orthogonal Strategies: Western Blot: PYGL Antibody [NBP1-86182] - Analysis in human cell lines PC-3 and SK-MEL-30 using Anti-PYGL antibody. Corresponding PYGL RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: PYGL Antibody [NBP1-86182] - Staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Independent Antibodies: Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86182] - Staining of human bone marrow, cerebral cortex, liver and testis using Anti-PYGL antibody (A) NBP1-86182 shows similar protein ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86182] - Analysis in human liver and pancreas tissues. Corresponding PYGL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86182] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86182] - Staining of human cerebral cortex shows no positivity in neurons.
Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86182] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86182] - Staining of human pancreas shows no positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86182] - Staining of human testis shows no positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PYGL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Specificity
Specificity of human PYGL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PYGL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using NBP1-86182.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PYGL Antibody

  • EC 2.4.1.1
  • glycogen phosphorylase, liver form
  • GSD6
  • phosphorylase, glycogen, liver
  • phosphorylase, glycogen; liver

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5510
Species: Hu
Applications: WB
NBP2-41176
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB110-78644
Species: Hu, Rt, Po, Bb, Bv, Gt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86893
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-75341
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-67413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
MAB9096
Species: Hu
Applications: WB, IHC
NBP1-86182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PYGL Antibody (NBP1-86182)(1)

Reviews for PYGL Antibody (NBP1-86182) (0)

There are no reviews for PYGL Antibody (NBP1-86182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PYGL Antibody (NBP1-86182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PYGL Products

Bioinformatics Tool for PYGL Antibody (NBP1-86182)

Discover related pathways, diseases and genes to PYGL Antibody (NBP1-86182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PYGL Antibody (NBP1-86182)

Discover more about diseases related to PYGL Antibody (NBP1-86182).
 

Pathways for PYGL Antibody (NBP1-86182)

View related products by pathway.

Research Areas for PYGL Antibody (NBP1-86182)

Find related products by research area.

Blogs on PYGL

There are no specific blogs for PYGL, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PYGL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PYGL
COVID-19 update