Novus Biologicals products are now on bio-techne.com

EIF2AK1 Antibody

Images

 
Western Blot: EIF2AK1 Antibody [NBP1-83210] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: EIF2AK1 Antibody [NBP1-83210] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EIF2AK1 Antibody [NBP1-83210] - Staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIF2AK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF2AK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIF2AK1 Protein (NBP1-83210PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EIF2AK1 Antibody

  • EC 2.7.11
  • eukaryotic translation initiation factor 2-alpha kinase 1
  • HCR
  • heme sensitive initiation factor 2a kinase
  • Heme-controlled repressor
  • Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase
  • Heme-regulated inhibitor
  • heme-regulated initiation factor 2-alpha kinase
  • heme-regulated repressor
  • Hemin-sensitive initiation factor 2-alpha kinase
  • HRIEC 2.7.11.1
  • KIAA1369heme regulated initiation factor 2 alpha kinase

Background

EIF2AK1 is encoded by this gene acts at the level of translation initiation to downregulate protein synthesis in response to stress. The encoded protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02669
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF7605
Species: Hu
Applications: WB
NBP2-37242
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
AF3999
Species: Hu
Applications: KO, WB
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
AF5725
Species: Hu
Applications: IHC
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-24813
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-58655
Species: Hu
Applications: ICC/IF
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-16674
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-01370
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-83210
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for EIF2AK1 Antibody (NBP1-83210) (0)

There are no publications for EIF2AK1 Antibody (NBP1-83210).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2AK1 Antibody (NBP1-83210) (0)

There are no reviews for EIF2AK1 Antibody (NBP1-83210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EIF2AK1 Antibody (NBP1-83210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF2AK1 Products

Research Areas for EIF2AK1 Antibody (NBP1-83210)

Find related products by research area.

Blogs on EIF2AK1

There are no specific blogs for EIF2AK1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF2AK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2AK1