HSD3B7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HSD3B7 Antibody [NBP2-14103] - Staining of human cell line Hep G2 shows localization to lipid droplets.

Immunohistochemistry-Paraffin: HSD3B7 Antibody [NBP2-14103] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: HSD3B7 Antibody [NBP2-14103] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Immunohistochemistry-Paraffin: HSD3B7 Antibody [NBP2-14103] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HSD3B7 Antibody [NBP2-14103] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HSD3B7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD3B7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HSD3B7 Protein (NBP2-14103PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HSD3B7 Antibody - BSA Free

• 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase
• 3 beta-hydroxysteroid dehydrogenase type 7
• 3 beta-hydroxysteroid dehydrogenase type VII
• 3-beta-HSD VII
• 7-alpha-diol 3-beta-dehydrogenase
• C(27) 3-beta-HSD
• C(27)-3BETA-HSD
• Cholest-5-ene-3-beta
• EC 1.1.1.-
• EC 1.1.1.181
• hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase
• PFIC4
• SDR11E3
• short chain dehydrogenase/reductase family 11E, member 3

Background

HSD3B7 codes for a protein with a length of 369 amino acids and a weight of approximately 41 kDa, with a shorter isoform with a length of 196 amino acids and a weight of approximately 21 kDa, and is a protein that plays a role in the biosynthesis of all classes of hormonal steroids, as it does not metabolize several different C steroids as substrates. It is also involved in bile acid synthesis from cholesterol. Current studies are being done on diseases and disorders relating to this gene including congenital bile acid synthesis defect, hepatitis, jaundice, cholesterol, tuberculosis, and neuronitis. HSD3B7 has also been shown to have interactions with PLSCR1, AKR1D1, CYP27A1, CYP39A1, and CYP7A1 in pathways such as the bile acid biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD3B7