HRD1 Antibody - BSA Free

Western Blot: HRD1 Antibody - BSA Free [HRD1] - Western blot analysis of lysates from Mouse pancreas using HRD1 Rabbit pAb at 1:3000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 20s.

Western Blot: HRD1 Antibody - BSA Free [HRD1] - Western blot analysis of various lysates using HRD1 Rabbit pAb at 1:3000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HRD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HRD1 Antibody - BSA Free (NBP3-02998) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human HRD1 (NP_757385.1). LEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYVN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 -1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for HRD1 Antibody - BSA Free

• E3 ubiquitin-protein ligase synoviolin
• EC 6.3.2
• HRD1EC 6.3.2.-
• KIAA1810Synovial apoptosis inhibitor 1
• MGC40372
• synovial apoptosis inhibitor 1, synoviolin

Background

HRD1 is a ubiquitin ligase whose expression is induced by the unfolded protein response (UPR) following endoplasmic reticulum stress. Expression of HRD1 protects cells from apoptosis by inducing degradation of abnormally processed proteins that accumulate in the endoplasmic reticulum. HRD1 is expressed in many tissues, strongly expressed in brain, pancreas, liver, kidney and skeletal muscle. It has been reported that Synoviolin/Hrd1 (expressed in rheumatoid synovium) is a novel causative factor for arthropathy by triggering synovial cell outgrowth through its anti-apoptotic effects. HRD1 contains one ring-type zinc finger.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYVN1