DAP5 Antibody

Images

 
Genetic Strategies: Western Blot: DAP5 Antibody [NBP1-85311] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EIF4G2 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: DAP5 Antibody [NBP1-85311] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western Blot: DAP5 Antibody [NBP1-85311] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

DAP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYH
Specificity
Specificity of human, mouse, rat DAP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF4G2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DAP5 Protein (NBP1-85311PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DAP5 Antibody

  • aging-associated protein 1
  • DAP-5
  • DAP5AAG1
  • Death-associated protein 5
  • eIF4G 2
  • eIF-4G 2
  • eIF-4-gamma 2
  • eukaryotic translation initiation factor 4 gamma 2
  • eukaryotic translation initiation factor 4 gamma, 2
  • eukaryotic translation initiation factor 4G-like 1
  • FLJ41344
  • NAT1
  • p97

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-61829
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5758
Species: Hu
Applications: WB, IHC, ICC
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for DAP5 Antibody (NBP1-85311) (0)

There are no publications for DAP5 Antibody (NBP1-85311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP5 Antibody (NBP1-85311) (0)

There are no reviews for DAP5 Antibody (NBP1-85311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DAP5 Antibody (NBP1-85311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAP5 Products

Bioinformatics Tool for DAP5 Antibody (NBP1-85311)

Discover related pathways, diseases and genes to DAP5 Antibody (NBP1-85311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAP5 Antibody (NBP1-85311)

Discover more about diseases related to DAP5 Antibody (NBP1-85311).
 

Pathways for DAP5 Antibody (NBP1-85311)

View related products by pathway.

PTMs for DAP5 Antibody (NBP1-85311)

Learn more about PTMs related to DAP5 Antibody (NBP1-85311).
 

Research Areas for DAP5 Antibody (NBP1-85311)

Find related products by research area.

Blogs on DAP5

There are no specific blogs for DAP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4G2