UBE2G2 Antibody (5E1) - Azide and BSA Free

Western Blot: UBE2G2 Antibody (5E1) [H00007327-M01] - UBE2G2 monoclonal antibody (M01), clone 5E1 Analysis of UBE2G2 expression in HeLa.

Immunohistochemistry-Paraffin: UBE2G2 Antibody (5E1) [H00007327-M01] - Analysis of monoclonal antibody to UBE2G2 on formalin-fixed paraffin-embedded human liver. Antibody concentration 1 ug/ml.

Western Blot: UBE2G2 Antibody (5E1) [H00007327-M01] - Analysis of UBE2G2 expression in transfected 293T cell line by UBE2G2 monoclonal antibody (M01), clone 5E1.Lane 1: UBE2G2 transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: UBE2G2 Antibody (5E1) [H00007327-M01] - Detection limit for recombinant GST tagged UBE2G2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 5E1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UBE2G2 Antibody (5E1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: UBE2G2 (NP_003329, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR
• Specificity: UBE2G2 - ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UBE2G2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2G2 Antibody (5E1) - Azide and BSA Free

• EC 6.3.2.19
• UBC7
• UBC7human ubiquitin conjugating enzyme G210ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7)
• UBE2G2
• Ubiquitin carrier protein G2
• ubiquitin conjugating enzyme 7
• ubiquitin conjugating enzyme G2
• ubiquitin-conjugating enzyme E2 G2
• ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
• Ubiquitin-protein ligase G2

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBE2G2 Antibody (H00007327-M01)(1)

Publication using H00007327-M01

• Durcan TM, Kontogiannea M, Bedard N et al. Ataxin-3 Deubiquitination Is Coupled to Parkin Ubiquitination via E2 Ubiquitin-conjugating Enzyme. J Biol Chem. 2011-11-11 [PMID: 22081612]

Bioinformatics

• Gene Symbol: UBE2G2
• Entrez:
  • 7327(Human)
• OMIM:
  • 603124(Human)
• Uniprot:
  • NP_003334.2(Human)