HO-1/HMOX1/HSP32 Antibody (5C6)

Images

 
Sandwich ELISA: HO-1/HMOX1/HSP32 Antibody (5C6) [H00003162-M01] - Detection limit for recombinant GST tagged HMOX1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HO-1/HMOX1/HSP32 Antibody (5C6) Summary

Immunogen
HMOX1 (ENSP00000216117, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPA
Marker
Oxidative Stress Marker
Specificity
HMOX1 - heme oxygenase (decycling) 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HMOX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HO-1/HMOX1/HSP32 Antibody (5C6)

  • bK286B10
  • EC 1.14.99.3
  • heat shock protein, 32-kD
  • heme oxygenase (decycling) 1
  • HMOX1
  • HO
  • HO1
  • HO-1
  • HO-1heme oxygenase 1
  • HSP32

Background

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01407
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003162-M01
Species: Hu
Applications: WB, ELISA

Publications for HO-1/HMOX1/HSP32 Antibody (H00003162-M01) (0)

There are no publications for HO-1/HMOX1/HSP32 Antibody (H00003162-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HO-1/HMOX1/HSP32 Antibody (H00003162-M01) (0)

There are no reviews for HO-1/HMOX1/HSP32 Antibody (H00003162-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HO-1/HMOX1/HSP32 Antibody (H00003162-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HO-1/HMOX1/HSP32 Products

Bioinformatics Tool for HO-1/HMOX1/HSP32 Antibody (H00003162-M01)

Discover related pathways, diseases and genes to HO-1/HMOX1/HSP32 Antibody (H00003162-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HO-1/HMOX1/HSP32 Antibody (H00003162-M01)

Discover more about diseases related to HO-1/HMOX1/HSP32 Antibody (H00003162-M01).
 

Pathways for HO-1/HMOX1/HSP32 Antibody (H00003162-M01)

View related products by pathway.

PTMs for HO-1/HMOX1/HSP32 Antibody (H00003162-M01)

Learn more about PTMs related to HO-1/HMOX1/HSP32 Antibody (H00003162-M01).
 

Research Areas for HO-1/HMOX1/HSP32 Antibody (H00003162-M01)

Find related products by research area.

Blogs on HO-1/HMOX1/HSP32

There are no specific blogs for HO-1/HMOX1/HSP32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HO-1/HMOX1/HSP32 Antibody (5C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol HMOX1
Entrez
OMIM
Uniprot