hnRNP H2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: hnRNP H2 Antibody [NBP1-89816] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human breast shows nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human kidney shows nuclear positivity.

Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human testis shows nuclear positivity.

Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human cerebellum shows nuclear positivity in cells in granular layer.

Analysis in human cell line MCF-7.

nbp1-89816_rabbit-polyclonal-hnrnp-h2-antibody-20920231742121.jpg

SMN, PLS3, hnRNP F, & hnRNP H1/2 associate in a large complex. a SMN & PLS3 independently associated with hnRNP H1/2 based on co-immunoprecipitation from HEK293T cells transfected with tagged proteins. b Endogenous PLS3, hnRNP F, & hnRNP H 1/2 associated with SMN in mouse brain extracts, based on immunoprecipitation with antisera against endogenous SMN protein. Arrowheads indicate the band of interest in blots with multiple bands. Heavy & light chain bands are labeled when present. c Endogenous SMN, hnRNP F, & hnRNP H1/2 associated with endogenous PLS3 using the same approach outlined in b. Arrowheads indicate the band of interest in blots with multiple bands. Heavy & light chain bands are labeled when present. IP on endogenous mouse brain extract was done from 3 independent brain extractions & preparations. d Size fractionation studies of whole cell lysates from HEK293T cells showed that actin, SMN, PLS3, & hnRNP F and/or H1/2 proteins co-fractionate in complexes of the indicated size (bracket), although the bulk of hnRNP F/H1/2 protein is in other smaller complexes. HEK293T cells were transfected with PLS3-Flag, & hnRNP F-GFP, endogenous hnRNP H1/2, actin, & SMN were detected using antisera Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32938453), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

hnRNP-H2-Antibody-Western-Blot-NBP1-89816-img0012.jpg

SMN, PLS3, hnRNP F, & hnRNP H1/2 associate in a large complex. a SMN & PLS3 independently associated with hnRNP H1/2 based on co-immunoprecipitation from HEK293T cells transfected with tagged proteins. b Endogenous PLS3, hnRNP F, & hnRNP H 1/2 associated with SMN in mouse brain extracts, based on immunoprecipitation with antisera against endogenous SMN protein. Arrowheads indicate the band of interest in blots with multiple bands. Heavy & light chain bands are labeled when present. c Endogenous SMN, hnRNP F, & hnRNP H1/2 associated with endogenous PLS3 using the same approach outlined in b. Arrowheads indicate the band of interest in blots with multiple bands. Heavy & light chain bands are labeled when present. IP on endogenous mouse brain extract was done from 3 independent brain extractions & preparations. d Size fractionation studies of whole cell lysates from HEK293T cells showed that actin, SMN, PLS3, & hnRNP F and/or H1/2 proteins co-fractionate in complexes of the indicated size (bracket), although the bulk of hnRNP F/H1/2 protein is in other smaller complexes. HEK293T cells were transfected with PLS3-Flag, & hnRNP F-GFP, endogenous hnRNP H1/2, actin, & SMN were detected using antisera Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32938453), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

hnRNP H2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit hnRNP H2 Antibody - BSA Free (NBP1-89816) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-hnRNP H2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFAS
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPH2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:10-1:250
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in Mouse brain lysate, separated by Size, antibody dilution of 1;10, 1:50, 1:250, apparent MW was 56 kDa
• Control Peptide:

  hnRNP H2 Protein (NBP1-89816PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for hnRNP H2 Antibody - BSA Free

• FTP-3
• FTP3hnRNP H2
• Heterogeneous nuclear ribonucleoprotein H'
• heterogeneous nuclear ribonucleoprotein H2 (H')
• heterogeneous nuclear ribonucleoprotein H2
• hnRNP H'
• hnRNPH'
• HNRPH'
• HNRPH2heterogeneous nuclear ribonucleoprotein H-prime

Background

The hnRNP H2 gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in th

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for hnRNP H2 Antibody (NBP1-89816)(1)

Publication using NBP1-89816

• Walsh MB, Janzen E, Wingrove E et al. Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy BMC biology 2020-09-16 [PMID: 32938453] (WB)

Bioinformatics

• Gene Symbol: HNRNPH2