Choline Kinase beta Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Choline Kinase beta Antibody [NBP1-85632] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Choline Kinase beta Antibody [NBP1-85632] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Choline Kinase beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWS
Specificity
Specificity of human Choline Kinase beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHKB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Choline Kinase beta Antibody

  • CHETK
  • CHETKcholine/ethanolamine kinase beta
  • CHKL
  • CHKLcholine kinase-like
  • ChoKB
  • Choline Kinase beta
  • choline kinase betaEK
  • Choline kinase-like protein
  • CK
  • CKB
  • CKEKB
  • CKEKBEKBcholine/ethanolamine kinase
  • EC 2.7.1.32
  • EC 2.7.1.82
  • EK
  • EKB
  • Ethanolamine Kinase beta
  • Ethanolamine kinase
  • MDCMC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85599
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84854
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA

Publications for Choline Kinase beta Antibody (NBP1-85632) (0)

There are no publications for Choline Kinase beta Antibody (NBP1-85632).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Choline Kinase beta Antibody (NBP1-85632) (0)

There are no reviews for Choline Kinase beta Antibody (NBP1-85632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Choline Kinase beta Antibody (NBP1-85632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Choline Kinase beta Products

Bioinformatics Tool for Choline Kinase beta Antibody (NBP1-85632)

Discover related pathways, diseases and genes to Choline Kinase beta Antibody (NBP1-85632). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Choline Kinase beta Antibody (NBP1-85632)

Discover more about diseases related to Choline Kinase beta Antibody (NBP1-85632).
 

Pathways for Choline Kinase beta Antibody (NBP1-85632)

View related products by pathway.

PTMs for Choline Kinase beta Antibody (NBP1-85632)

Learn more about PTMs related to Choline Kinase beta Antibody (NBP1-85632).
 

Research Areas for Choline Kinase beta Antibody (NBP1-85632)

Find related products by research area.

Blogs on Choline Kinase beta

There are no specific blogs for Choline Kinase beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Choline Kinase beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHKB