SHMT2 Antibody

Images

 
Independent Antibodies: Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis using Anti-SHMT2 antibody NBP1-80754 (A) shows similar pattern to independent antibody NBP1-80755 (B).
Immunocytochemistry/ Immunofluorescence: SHMT2 Antibody [NBP1-80754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human kidney.
Western Blot: SHMT2 Antibody [NBP1-80754] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis in human cell line RH-30.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human lymph node shows moderate granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining in human liver and skeletal muscle tissues. Corresponding SHMT2 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human colon, kidney, liver and skin using Anti-SHMT2 antibody NBP1-80754 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human skin.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHMT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF
Specificity
Specificity of human, mouse, rat SHMT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHMT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHMT2 Protein (NBP1-80754PEP)
Publications
Read Publication using
NBP1-80754 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25855294).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHMT2 Antibody

  • EC 2.1.2.1
  • GLY A+
  • GLYA
  • glycine auxotroph A, human complement for hamster
  • Glycine hydroxymethyltransferase
  • serine aldolase
  • serine hydroxymethylase
  • serine hydroxymethyltransferase 2 (mitochondrial)
  • serine hydroxymethyltransferase, mitochondrial
  • Serine methylase
  • SHMT
  • threonine aldolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34441
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-66056
Species: Hu
NBP1-57749
Species: Hu
Applications: WB, IHC
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1936
Species: Hu
Applications: WB, IP
NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32907
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SHMT2 Antibody (NBP1-80754)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SHMT2 Antibody (NBP1-80754) (0)

There are no reviews for SHMT2 Antibody (NBP1-80754). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHMT2 Antibody (NBP1-80754) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SHMT2 Antibody (NBP1-80754)

Discover related pathways, diseases and genes to SHMT2 Antibody (NBP1-80754). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHMT2 Antibody (NBP1-80754)

Discover more about diseases related to SHMT2 Antibody (NBP1-80754).
 

Pathways for SHMT2 Antibody (NBP1-80754)

View related products by pathway.

PTMs for SHMT2 Antibody (NBP1-80754)

Learn more about PTMs related to SHMT2 Antibody (NBP1-80754).

Blogs on SHMT2

There are no specific blogs for SHMT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHMT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHMT2