Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF |
Specificity | Specificity of human SHMT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SHMT2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | IHC reported in scientific literature (PMID: 25855294). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-80754 | Applications | Species |
---|---|---|
Kim D, Fiske BP, Birsoy K et al. SHMT2 drives glioma cell survival in the tumor microenvironment but imposes a dependence on glycine clearance. Nature 2015 Apr 16 [PMID: 25855294] (IHC, Human) | IHC | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for SHMT2 Antibody (NBP1-80754)Discover more about diseases related to SHMT2 Antibody (NBP1-80754).
| Pathways for SHMT2 Antibody (NBP1-80754)View related products by pathway.
|
PTMs for SHMT2 Antibody (NBP1-80754)Learn more about PTMs related to SHMT2 Antibody (NBP1-80754).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.