SHMT2 Antibody

Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis using Anti-SHMT2 antibody NBP1-80754 (A) shows similar pattern to independent antibody NBP1-80755 (B).

Immunocytochemistry/Immunofluorescence: SHMT2 Antibody [NBP1-80754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human kidney.

Western Blot: SHMT2 Antibody [NBP1-80754] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis in human cell line RH-30.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human lymph node shows moderate granular cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining in human liver and skeletal muscle tissues. Corresponding SHMT2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human colon, kidney, liver and skin using Anti-SHMT2 antibody NBP1-80754 (A) shows similar protein distribution across tissues to independent antibody NBP1-80755 (B).

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human skin.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human colon.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SHMT2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF
• Specificity: Specificity of human, mouse, rat SHMT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHMT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SHMT2 Protein (NBP1-80754PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25855294).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SHMT2 Antibody

• EC 2.1.2.1
• GLY A+
• GLYA
• glycine auxotroph A, human complement for hamster
• Glycine hydroxymethyltransferase
• serine aldolase
• serine hydroxymethylase
• serine hydroxymethyltransferase 2 (mitochondrial)
• serine hydroxymethyltransferase, mitochondrial
• Serine methylase
• SHMT
• threonine aldolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SHMT2 Antibody (NBP1-80754)(1)

Publication using NBP1-80754

• Kim D, Fiske BP, Birsoy K et al. SHMT2 drives glioma cell survival in the tumor microenvironment but imposes a dependence on glycine clearance. Nature 2015 Apr 16 [PMID: 25855294] (IHC, Human)

Bioinformatics

• Gene Symbol: SHMT2