Home » SHMT2 » SHMT2 Antibodies » SHMT2 Antibody

SHMT2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis using Anti-SHMT2 antibody NBP1-80754 (A) shows similar pattern to independent antibody NBP1-80755 (B).
Independent Antibodies: Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis using Anti-SHMT2 antibody NBP1-80754 (A) shows similar pattern to independent antibody NBP1-80755 (B).
Immunocytochemistry/ Immunofluorescence: SHMT2 Antibody [NBP1-80754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Western Blot: SHMT2 Antibody [NBP1-80754] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis in human cell line RH-30.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human lymph node shows moderate granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining in human liver and skeletal muscle tissues. Corresponding SHMT2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human skin.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human colon.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human kidney.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human liver using Anti-SHMT2 antibody NBP1-80754.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human duodenum, liver, lymph node and skeletal muscle using Anti-SHMT2 antibody NBP1-80754 (A) shows similar protein distribution across tissues ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

SHMT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF
Specificity
Specificity of human SHMT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHMT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25855294). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHMT2 Protein (NBP1-80754PEP)
Publications
Read Publication using
NBP1-80754 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25855294).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHMT2 Antibody

  • EC 2.1.2.1
  • GLY A+
  • GLYA
  • glycine auxotroph A, human complement for hamster
  • Glycine hydroxymethyltransferase
  • serine aldolase
  • serine hydroxymethylase
  • serine hydroxymethyltransferase 2 (mitochondrial)
  • serine hydroxymethyltransferase, mitochondrial
  • Serine methylase
  • SHMT
  • threonine aldolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Thymidylate
Synthase Antibody (SP
NBP2-34390
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human Testicular Carcinoma stained with Thymidylate Synthase Antibody (SPM453).
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on Hek293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on HEK293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the Azide and BSA Free format of this antibody.
(1 Review)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
SHMT1 Antibody
NBP2-32173
Western Blot: SHMT1 Antibody [NBP2-32173] - Samples: Whole cell lysate (50 ug) from NIH3T3 cells. Antibodies: Affinity purified rabbit anti-SHMT1 antibody NBP2-32173 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP2-32173] - Section of mouse teratoma. Antibody: Affinity purified rabbit anti- SHMT1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).
Western Blot: SHMT1 Antibody [NBP2-32173] - Samples: Whole cell lysate (50 ug) from Jurkat cells. Antibodies: Affinity purified rabbit anti-SHMT1 NBP2-32173 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
MTHFR Antibody
(5D3)
NBP2-37607
Western Blot: MTHFR Antibody (5D3) [NBP2-37607] - Western blot analysis using MTHFR mouse mAb against Rat Heart cell lysate.
Immunohistochemistry-Paraffin: MTHFR Antibody (5D3) [NBP2-37607] - Analysis of intima cancer tissues (left) and prostate tissues (right) using MTHFR mouse mAb with DAB staining.
Western Blot: MTHFR Antibody (5D3) [NBP2-37607] - Western blot analysis using MTHFR mAb against HEK293 (1) and MTHFR(AA: 339-499)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Peroxiredoxin 5
Antibody [Unconjugate
AF5724
Western blot shows lysates of human, mouse, and rat brain tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Peroxiredoxin 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5724) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Peroxiredoxin 5 at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Peroxiredoxin 5 was detected in immersion fixed A549 human lung carcinoma cell line using Goat Anti-Human/Mouse/Rat Peroxiredoxin 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5724) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to mitochondria. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Peroxiredoxin 5 was detected in immersion fixed A549 human lung carcinoma cell line using Goat Anti-Human/Mouse/Rat Peroxiredoxin 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5724) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm (mitochondria). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu, Rt
Applications: WB, ICC
PDXP Antibody
NBP2-27461
Western Blot: PDXP Antibody [NBP2-27461] - 0.1 ug/ml staining of Mouse (A) and Rat (B) Brain lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: PDXP Antibody [NBP2-27461] - 5ug/ml staining of paraffin embedded Human Tonsil. Steamed antigen retrieval with citrate buffer Ph 6, AP-staining.
Western Blot: PDXP Antibody [NBP2-27461] - NBP2-27461 (0.1ug/ml) staining of Human Heart lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Myelin PLP Antibody
NBP1-87781
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Border of a demyelinated lesion. Image from a verified customer review.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human pancreas shows low expression as expected.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PTHLH/PTHrP
Antibody
NBP1-59322
Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - HepG2 cell lysate, Antibody Titration: 2.0ug/ml
Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary, Antibody Dilution: 1 : 2000.
Species: Hu
Applications: WB, IHC, IHC-P
Dihydrofolate
Reductase/DHFR Antibo ...
H00001719-M01
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Folic acid treatment restores endothelial specific DHFR expression and activity in Ang II-infused apoE null mice.DHFR expression (A, n?=?8-11) and activity (B, n?=?5-7) measured from endothelial cells (ECs) and EC-denuded aortas isolated from apoE null mice after 4 weeks of infusion. Data show that DHFR expression and activity was restored in FA treated animals specifically in the endothelial cells. eNOS was stained to show that isolation/removal of ECs from the vessels was successful. *p<0.05. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0088899) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of monoclonal antibody to DHFR on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10 Analysis of DHFR expression in HeLa.
(13 Publications)
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
MTR Antibody
NB100-791
Western Blot: MTR Antibody [NB100-791] - Cgl null mice exhibit female-specific alteration of enzymes involved in the remethylation of methionine. Western blotting analysis of hepatic BHMT, MTHFR and MTR protein expression levels in male and female WT and Cgl null mice. Values shown represent the mean+-s.d., *Pless than 0.05, **Pless than 0.01, ***Pless than 0.001. Image collected and cropped by CiteAb from the following publication (//bio.biologists.org/cgi/doi/10.1242/bio.013433) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: MTR Antibody [NB100-791] - Human adrenal gland. Antibody at 3.8 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
MTRR Antibody
NBP1-57749
Western Blot: MTRR Antibody [NBP1-57749] - Antibody Titration: 1 ug/ml Positive control: Hela cell lysate.
Immunohistochemistry: MTRR Antibody [NBP1-57749] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: MTRR Antibody [NBP1-57749] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
PHGDH Antibody
NBP1-87311
Western Blot: PHGDH Antibody [NBP1-87311] - Analysis: NBP1-87311 (A) shows similar pattern to independent antibody NBP1-87310 (B)
Immunocytochemistry/Immunofluorescence: PHGDH Antibody [NBP1-87311] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Serine Dehydratase
Antibody (OTI3D3)
NBP2-01506
Western Blot: Serine Dehydratase Antibody (3D3) [NBP2-01506] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Serine Dehydratase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by Serine Dehydratase-PAGE and immunoblotted with anti-Serine Dehydratase.
Immunocytochemistry/Immunofluorescence: Serine Dehydratase Antibody (3D3) [NBP2-01506] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Serine Dehydratase.
Immunohistochemistry-Paraffin: Serine Dehydratase Antibody (3D3) [NBP2-01506] - Staining of paraffin-embedded Human breast tissue using anti-Serine Dehydratase mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Western Blot: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of hnRNP C1+C2 on different lysates using anti-hnRNP C1+C2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: MCF-7 Lane 3: HepG2
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in B16-F1 (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of paraffin-embedded mouse skin tissue using anti-hnRNP C1+C2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Thromboxane
synthase Antibody (OT
NBP2-02710
Western Blot: Thromboxane synthase Antibody (2C1) [NBP2-02710] Analysis of extracts (35ug) from 9 different cell lines by using anti-Thromboxane synthase monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Thromboxane synthase.
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Staining of paraffin-embedded Human liver tissue using anti-Thromboxane synthase mouse monoclonal antibody.
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Cav1.2 Antibody
NBP2-76914
Immunocytochemistry/Immunofluorescence: Cav1.2 Antibody [NBP2-76914] - ICC staining CACNA1C in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Cav1.2 Antibody [NBP2-76914] - Immunohistochemical analysis of paraffin-embedded mouse heart tissue using anti-CACNA1C antibody. Counter stained with hematoxylin.
Flow Cytometry: Cav1.2 Antibody [NBP2-76914] - Flow cytometric analysis of SKOV-3 cells with CACNA1C antibody at 1/100 dilution (fuchsia) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
Human Complement
Component C2 ELISA Ki ...
NBP2-60548
ELISA: Human Complement Component C2 ELISA Kit (Colorimetric) [NBP2-60548] - Standard curve.
Species: Hu
MTHFD1 Antibody
NBP1-82612
Western Blot: MTHFD1 Antibody [NBP1-82612] - Analysis using Anti-MTHFD1 antibody NBP1-82612 (A) shows similar pattern to independent antibody NBP1-82611 (B).
Immunohistochemistry-Paraffin: MTHFD1 Antibody [NBP1-82612] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Western Blot: MTHFD1 Antibody [NBP1-82612] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
ARHGAP4 Antibody
NBP1-88527
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon.
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in human cell line RPMI-8226.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
GLDC Antibody
NBP1-32907
Western Blot: GLDC Antibody [NBP1-32907] - Whole cell extract (30 ug) was separated by 5% SDS-PAGE, and the membranes were blotted with Glycine dehydrogenase antibody [N3C2-2], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: GLDC Antibody [NBP1-32907] - Hep G2 cells were fixed in ice-cold MeOH for 5 min. Green: Glycine dehydrogenase protein stained by Glycine dehydrogenase antibody [N3C2-2], Internal diluted at 1:400. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-32907] - Paraffin-embedded mouse brain. Glycine dehydrogenase antibody [N3C2-2], Internal diluted at 1:500.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
SHMT2 Antibody
NBP1-80754
SHMT2 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SHMT2 Antibody (NBP1-80754)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SHMT2 Antibody (NBP1-80754) (0)

There are no reviews for SHMT2 Antibody (NBP1-80754). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHMT2 Antibody (NBP1-80754) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SHMT2 Products

Bioinformatics Tool for SHMT2 Antibody (NBP1-80754)

Discover related pathways, diseases and genes to SHMT2 Antibody (NBP1-80754). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHMT2 Antibody (NBP1-80754)

Discover more about diseases related to SHMT2 Antibody (NBP1-80754).
 

Pathways for SHMT2 Antibody (NBP1-80754)

View related products by pathway.

PTMs for SHMT2 Antibody (NBP1-80754)

Learn more about PTMs related to SHMT2 Antibody (NBP1-80754).

Blogs on SHMT2

There are no specific blogs for SHMT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHMT2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SHMT2
Entrez
Uniprot