hnRNP F Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS |
| Predicted Species |
Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HNRNPF |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for hnRNP F Antibody - BSA Free
Background
Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport, and also bind heterogeneous nuclear RNA (hnRNA), which are the transcripts produced by RNA polymerase II. hnRNP complexes are the major constituents of the spliceosome and in particular, the hnRNP A1 protein is one of the major premRNA/ mRNA binding proteins and also one of the most abundant proteins in the nucleus. hnRNP A1 and A2/B1 regulate the processing of pre-mRNA by directly antagonizing the association of various splicing factors and by influencing the splice site selection on pre-mRNA. The majority of hnRNP proteins components are localized to the nucleus; however some shuttle between the nucleus and the cytoplasm. Most hnRNP proteins, including hnRNP C1 and C2, contain one or more RNA binding domains and are implicated in the processing of pre-mRNA. hnRNPs F and H are largely related factors that preferentially associate with poly(rG) regions on RNA. Isoforms of these proteins are often generated by alternative processing of the premRNA and by posttranslational modifications such as phosphorylation on serines and threonines and methylation of arginines.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for hnRNP F Antibody (NBP2-57442) (0)
There are no publications for hnRNP F Antibody (NBP2-57442).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for hnRNP F Antibody (NBP2-57442) (0)
There are no reviews for hnRNP F Antibody (NBP2-57442).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for hnRNP F Antibody (NBP2-57442) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional hnRNP F Products
Research Areas for hnRNP F Antibody (NBP2-57442)
Find related products by research area.
|
Blogs on hnRNP F