Hemopexin Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Hemopexin Antibody - BSA Free (NBP3-21321) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HPX |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Hemopexin Antibody - BSA Free
Background
The Hemopexin gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phaseprotein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidativestress. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Publications for Hemopexin Antibody (NBP3-21321) (0)
There are no publications for Hemopexin Antibody (NBP3-21321).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hemopexin Antibody (NBP3-21321) (0)
There are no reviews for Hemopexin Antibody (NBP3-21321).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Hemopexin Antibody (NBP3-21321) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hemopexin Products
Research Areas for Hemopexin Antibody (NBP3-21321)
Find related products by research area.
|
Blogs on Hemopexin