Hemoglobin A1 Antibody


Western Blot: Hemoglobin A1 Antibody [NBP2-54711] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Hemoglobin A1 Antibody [NBP2-54711] - Staining of human colon shows distinct staining in red blood cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Hemoglobin A1 Antibody Summary

This antibody was developed against a Recombinant Protein corresponding to amino acids: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hemoglobin A1 Recombinant Protein Antigen (NBP2-54711PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Hemoglobin A1 Antibody

  • alpha one globin
  • alpha-1 globin
  • alpha-1-globin
  • alpha-globin
  • CD31
  • hemoglobin alpha 1 globin chain
  • Hemoglobin alpha chain
  • hemoglobin alpha-1 chain
  • hemoglobin subunit alpha
  • hemoglobin, alpha 1
  • MGC126895
  • MGC126897


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Hemoglobin A1 Antibody (NBP2-54711) (0)

There are no publications for Hemoglobin A1 Antibody (NBP2-54711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hemoglobin A1 Antibody (NBP2-54711) (0)

There are no reviews for Hemoglobin A1 Antibody (NBP2-54711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hemoglobin A1 Antibody (NBP2-54711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Hemoglobin A1 Products

Bioinformatics Tool for Hemoglobin A1 Antibody (NBP2-54711)

Discover related pathways, diseases and genes to Hemoglobin A1 Antibody (NBP2-54711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hemoglobin A1 Antibody (NBP2-54711)

Discover more about diseases related to Hemoglobin A1 Antibody (NBP2-54711).

Pathways for Hemoglobin A1 Antibody (NBP2-54711)

View related products by pathway.

PTMs for Hemoglobin A1 Antibody (NBP2-54711)

Learn more about PTMs related to Hemoglobin A1 Antibody (NBP2-54711).

Research Areas for Hemoglobin A1 Antibody (NBP2-54711)

Find related products by research area.

Blogs on Hemoglobin A1

There are no specific blogs for Hemoglobin A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Hemoglobin A1 Antibody and receive a gift card or discount.


Gene Symbol HBA1