Hemoglobin A1 Antibody (1R1N7)

Western Blot: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Analysis of extracts of Rat liver, using Hemoglobin A1 (HBA1) Rabbit mAb (NBP3-16804) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunofluorescence analysis of mouse spleen using Hemoglobin A1 (HBA1) Rabbit mAb (NBP3-16804) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunofluorescence analysis of rat spleen using Hemoglobin A1 (HBA1) Rabbit mAb (NBP3-16804) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunofluorescence analysis of paraffin-embedded human spleen using Hemoglobin A1 (HBA1) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1R1N7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Hemoglobin A1 Antibody (1R1N7) Summary

• Description: Novus Biologicals Rabbit Hemoglobin A1 Antibody (1R1N7) (NBP3-16804) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin A1 (HBA1) (P69905). MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HBA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 15 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Hemoglobin A1 Antibody (1R1N7)

• alpha one globin
• alpha-1 globin
• alpha-1-globin
• alpha-globin
• CD31
• hemoglobin alpha 1 globin chain
• Hemoglobin alpha chain
• hemoglobin alpha-1 chain
• hemoglobin subunit alpha
• hemoglobin, alpha 1
• MGC126895
• MGC126897

Background

The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HBA1