Recombinant Human HDAC5 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human HDAC5 Protein [H00010014-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human HDAC5 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 330-429 of Human HDAC5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HDAC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HDAC5 GST (N-Term) Protein

  • Antigen NY-CO-9
  • EC 3.5.1.98
  • FLJ90614
  • HD5
  • Histone Deacetylase 5
  • KIAA0600
  • NY-CO-9

Background

HDAC5 - histone deacetylase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP2-22151
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004205-M15
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-67891
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-67451
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-17260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-44092
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1364
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-60002
Species: Hu
Applications: DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
H00010014-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for HDAC5 Partial Recombinant Protein (H00010014-Q01) (0)

There are no publications for HDAC5 Partial Recombinant Protein (H00010014-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDAC5 Partial Recombinant Protein (H00010014-Q01) (0)

There are no reviews for HDAC5 Partial Recombinant Protein (H00010014-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HDAC5 Partial Recombinant Protein (H00010014-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HDAC5 Products

Array H00010014-Q01

Bioinformatics Tool for HDAC5 Partial Recombinant Protein (H00010014-Q01)

Discover related pathways, diseases and genes to HDAC5 Partial Recombinant Protein (H00010014-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDAC5 Partial Recombinant Protein (H00010014-Q01)

Discover more about diseases related to HDAC5 Partial Recombinant Protein (H00010014-Q01).
 

Pathways for HDAC5 Partial Recombinant Protein (H00010014-Q01)

View related products by pathway.

PTMs for HDAC5 Partial Recombinant Protein (H00010014-Q01)

Learn more about PTMs related to HDAC5 Partial Recombinant Protein (H00010014-Q01).
 

Research Areas for HDAC5 Partial Recombinant Protein (H00010014-Q01)

Find related products by research area.

Blogs on HDAC5.

SREBP2: From Cholesterol Homeostasis to Cancer Invasion
Sterol-regulatory-element-binding protein 2 (SREBP2) is a transcription factor that regulates cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. HMG-CoA. Along with another transcription factor LXR, SREBP...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HDAC5 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC5