HAND2 Antibody

Images

 
Western Blot: HAND2 Antibody [NBP1-74185] - Titration: 1.0 ug/ml Positive Control: Mouse Heart
Western Blot: HAND2 Antibody [NBP1-74185] - WB detection of Hand2 protein in mouse heart lysate with rabbit polyclonal HAND2 antibody used at 1.0ug/ml concentration.
Western Blot: HAND2 Antibody [NBP1-74185] - Sample Type: Mouse Heart lysates Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAND2 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Hand2. Immunizing peptide sequence DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAND2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Hand2 and was validated on Western blot.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HAND2 Antibody

  • BHLHA26
  • bHLHa26MGC125303
  • dHand
  • DHAND2
  • Ehand2
  • FLJ16260
  • HAND2
  • heart and neural crest derivatives expressed 2
  • heart, autonomic nervous system and neural crestderivatives-expressed protein 2
  • Hed
  • MGC125304
  • Th2
  • Thing2

Background

Hand2 is essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. It is required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. It plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Hand2 is involved in the development of branchial arches, which give rise to unique structures in the head and neck.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00576
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-41169
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
AF4940
Species: Hu, Mu
Applications: ICC
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF922
Species: Hu
Applications: WB, Block
NBP2-13958
Species: Hu
Applications: IHC, IHC-P

Publications for HAND2 Antibody (NBP1-74185) (0)

There are no publications for HAND2 Antibody (NBP1-74185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAND2 Antibody (NBP1-74185) (0)

There are no reviews for HAND2 Antibody (NBP1-74185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HAND2 Antibody (NBP1-74185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAND2 Products

Bioinformatics Tool for HAND2 Antibody (NBP1-74185)

Discover related pathways, diseases and genes to HAND2 Antibody (NBP1-74185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAND2 Antibody (NBP1-74185)

Discover more about diseases related to HAND2 Antibody (NBP1-74185).
 

Pathways for HAND2 Antibody (NBP1-74185)

View related products by pathway.

PTMs for HAND2 Antibody (NBP1-74185)

Learn more about PTMs related to HAND2 Antibody (NBP1-74185).

Blogs on HAND2

There are no specific blogs for HAND2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAND2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAND2
Entrez
Uniprot