PHOX2A Antibody (4F6)

Western Blot: PHOX2A Antibody (4F6) [H00000401-M01] - Analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody (M01), clone 4F6.Lane 1: PHOX2A transfected lysate(29.7 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PHOX2A Antibody (4F6) [H00000401-M01] - Analysis of monoclonal antibody to PHOX2A on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: PHOX2A Antibody (4F6) [H00000401-M01] - Analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi ( Cat # H00000401-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PHOX2A monoclonal antibody (M01), clone 4F6 (Cat # H00000401-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: PHOX2A Antibody (4F6) [H00000401-M01] - PHOX2A monoclonal antibody (M01), clone 4F6 Analysis of PHOX2A expression in PC-12.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, KD
• Clone: 4F6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

PHOX2A Antibody (4F6) Summary

• Immunogen: PHOX2A (NP_005160, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
• Specificity: PHOX2A - paired-like (aristaless) homeobox 2a
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PHOX2A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 30315878).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHOX2A Antibody (4F6)

• aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive
• aristaless homeobox homolog
• Aristaless homeobox protein homolog
• arix homeodomain protein
• ARIX1 homeodomain protein
• ARIXNCAM2
• CFEOM2MGC52227
• paired mesoderm homeobox protein 2A
• paired-like homeobox 2apaired-like (aristaless) homeobox 2a
• PMX2AFEOM2

Background

The protein encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHOX2A Antibody (H00000401-M01)(1)

Publication using H00000401-M01

• Fan Y, Chen P, Raza MU et al. Altered Expression of Phox2 Transcription Factors in the Locus Coeruleus in Major Depressive Disorder Mimicked by Chronic Stress and Corticosterone Treatment In Vivo and In Vitro. Neuroscience. 2018-10-11 [PMID: 30315878] (IF/IHC, Rat)

Bioinformatics

• Gene Symbol: PHOX2A
• Entrez:
  • 401(Human)
• OMIM:
  • 602078(Human)
• Uniprot:
  • NP_005160(Human)