PHOX2A Antibody (4F6)

Images

 
Western Blot: PHOX2A Antibody (4F6) [H00000401-M01] - Analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody (M01), clone 4F6.Lane 1: PHOX2A transfected lysate(29.7 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: PHOX2A Antibody (4F6) [H00000401-M01] - Analysis of monoclonal antibody to PHOX2A on HeLa cell. Antibody concentration 10 ug/ml.
Genetic Strategies: Western Blot: PHOX2A Antibody (4F6) [H00000401-M01] - Analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi ( Cat # H00000401-R01V ) (Lane 2) or ...read more
Western Blot: PHOX2A Antibody (4F6) [H00000401-M01] - PHOX2A monoclonal antibody (M01), clone 4F6 Analysis of PHOX2A expression in PC-12.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, KD
Clone
4F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

PHOX2A Antibody (4F6) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PHOX2A (NP_005160, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
Specificity
PHOX2A - paired-like (aristaless) homeobox 2a
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PHOX2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 30315878).
Publications
Read Publication using
H00000401-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHOX2A Antibody (4F6)

  • aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive
  • aristaless homeobox homolog
  • Aristaless homeobox protein homolog
  • arix homeodomain protein
  • ARIX1 homeodomain protein
  • ARIXNCAM2
  • CFEOM2MGC52227
  • paired mesoderm homeobox protein 2A
  • paired-like homeobox 2apaired-like (aristaless) homeobox 2a
  • PMX2AFEOM2

Background

The protein encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHOX2A Antibody (H00000401-M01)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for PHOX2A Antibody (H00000401-M01) (0)

There are no reviews for PHOX2A Antibody (H00000401-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHOX2A Antibody (H00000401-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHOX2A Products

Research Areas for PHOX2A Antibody (H00000401-M01)

Find related products by research area.

Blogs on PHOX2A

There are no specific blogs for PHOX2A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHOX2A Antibody (4F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PHOX2A
Entrez
OMIM
Uniprot