TBX5 Antibody (1G10)

Images

 
Western Blot: TBX5 Antibody (1G10) [H00006910-M01] - Analysis of TBX5 over-expressed 293 cell line, cotransfected with TBX5 Validated Chimera RNAi ( Cat # H00006910-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: TBX5 Antibody (1G10) [H00006910-M01] - Analysis of TBX5 expression in transfected 293T cell line by TBX5 monoclonal antibody (M01), clone 1G10.Lane 1: TBX5 transfected lysate(57.7 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity Hu, Mu, Fi, PmSpecies Glossary
Applications WB, ELISA, ICC/IF, KD
Clone
1G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TBX5 Antibody (1G10) Summary

Immunogen
TBX5 (AAH27942, 402 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
Specificity
TBX5 - T-box 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TBX5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Knockdown Validated
  • Western Blot
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Publications
Read Publications using H00006910-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TBX5 Antibody (1G10)

  • HOS
  • T-box 5
  • T-box protein 5
  • T-box transcription factor TBX5
  • TBX5

Background

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31558
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-85889
Species: Hu
Applications: WB
AF4509
Species: Hu
Applications: ICC, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB8124
Species: Hu
Applications: ICC
345-FG
Species: Hu
Applications: BA
464-SH/CF
Species: Mu
Applications: BA
H00006909-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-46568
Species: Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-88644
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00493
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00006910-M01
Species: Hu, Mu, Fi, Pm
Applications: WB, ELISA, ICC/IF, KD

Publications for TBX5 Antibody (H00006910-M01)(4)

Reviews for TBX5 Antibody (H00006910-M01) (0)

There are no reviews for TBX5 Antibody (H00006910-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBX5 Antibody (H00006910-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBX5 Products

Bioinformatics Tool for TBX5 Antibody (H00006910-M01)

Discover related pathways, diseases and genes to TBX5 Antibody (H00006910-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX5 Antibody (H00006910-M01)

Discover more about diseases related to TBX5 Antibody (H00006910-M01).
 

Pathways for TBX5 Antibody (H00006910-M01)

View related products by pathway.

PTMs for TBX5 Antibody (H00006910-M01)

Learn more about PTMs related to TBX5 Antibody (H00006910-M01).

Blogs on TBX5

There are no specific blogs for TBX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX5 Antibody (1G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX5
Entrez
OMIM
Uniprot