Novus Biologicals products are now on bio-techne.com

HAND1 Antibody

Images

 
Staining of human cell line SH-SY5Y shows localization to nucleoplasm & nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAND1 Antibody Summary

Immunogen
This antibody has been engineered to specifically recognize the recombinant protein HAND1 using the following amino acid sequence: HPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFP
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAND1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HAND1 Antibody

  • BHLHA27
  • bHLHa27heart- and neural crest derivatives-expressed protein 1
  • Class A basic helix-loop-helix protein 27
  • eHand
  • Extraembryonic tissues, heart, autonomic nervous system and neural crestderivatives-expressed protein 1
  • HAND1
  • heart and neural crest derivatives expressed 1
  • Hxt
  • Thing1

Background

HAND1 is encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3876
Species: Hu, Mu
Applications: IHC, WB
AF2444
Species: Hu
Applications: IHC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-24583
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
AF6539
Species: Hu
Applications: IHC, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
AF6166
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
NBP2-13957
Species: Hu
Applications: IHC, IHC-P, WB
NB100-109
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, Single-Cell Western, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-46376
Species: Hu
Applications: IHC, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
NBP2-61141
Species: Hu
Applications: ICC/IF, IHC
AF6116
Species: Hu
Applications: ICC, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF5045
Species: Hu, Mu
Applications: IHC, WB
NBP3-24890
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for HAND1 Antibody (NBP3-24890) (0)

There are no publications for HAND1 Antibody (NBP3-24890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAND1 Antibody (NBP3-24890) (0)

There are no reviews for HAND1 Antibody (NBP3-24890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HAND1 Antibody (NBP3-24890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAND1 Products

Research Areas for HAND1 Antibody (NBP3-24890)

Find related products by research area.

Blogs on HAND1

There are no specific blogs for HAND1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAND1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAND1