Guanylyl Cyclase beta 1 Antibody - BSA Free

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human cerebellum shows strong cytoplasmic positivity in molecular layer.

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Rt, Mu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Guanylyl Cyclase beta 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Guanylyl Cyclase beta 1 Antibody - BSA Free (NBP1-89784) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-Guanylyl Cyclase beta 1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GUCY1B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: Tested in Muscle, separated by Size, antibody dilution of 1:50
• Control Peptide:

  Guanylyl Cyclase beta 1 Protein (NBP1-89784PEP)

Reactivity Notes

Use in Rat reported in scientific literature (PMID:34871799) .

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Guanylyl Cyclase beta 1 Antibody - BSA Free

• EC 4.6.1.2
• GC-SB3
• GCS-beta-1
• GCS-beta-3
• guanylate cyclase 1, soluble, beta 3
• guanylate cyclase soluble subunit beta-1
• Guanylate cyclase soluble subunit beta-3
• GUC1B3GUCB3
• GUCSB3GC-S-beta-1
• GUCY1B1
• Soluble guanylate cyclase small subunit

Background

Guanylate Cyclase is an heterodimer of an alpha and a beta chain. Its enzymatic activity transforms GTP to GMP releasing a diphosphate. It binds 1 or 2 hemes per heterodimer. It is activated by nitric oxide in the presence of magnesium or manganese ions. There are two types of guanylate cyclase: soluble form and membrane-associated receptor form.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Guanylyl Cyclase beta 1 Antibody (NBP1-89784)(2)

Publications using NBP1-89784

• Kimura S, Kawamorita N, Kikuchi Y et al. Low-energy shock wave therapy ameliorates ischemic-induced overactive bladder in a rat model with angiogenesis and increased expression of guanylate cyclase Research Square 2022-06-09 [PMID: 36536004] (WB, Rat)
• Weber RE, Schulze KM, Colburn TD et al. Capillary hemodynamics and contracting skeletal muscle oxygen pressures in male rats with heart failure: Impact of soluble guanylyl cyclase activator Nitric oxide : biology and chemistry 2021-12-04 [PMID: 34871799] (WB, Rat)

FAQs for Guanylyl Cyclase beta 1 Antibody (NBP1-89784). (Showing 1 - 1 of 1 FAQs).

1. We are searching for antibodies raised against soluble guanylyl cyclase and NMDA-receptor. Both antibodies would be used on a mollusk (Helix pomatia). In some cases we could not find sequence information on your antibodies target. We can give you the sequences of both proteins described in a mollusk (Lymnaea) standing closest to that our target species. I hope some of your immunogen sequences used for antibody production will match with high confidence with a part of these protein sequences. Would you so kind as to help us finding the most promising antibody from your palette.
   • In regards to your inquiry, unfortunately with this being an organism that is not commonly studied by our researchers we don't have many products that match up with this one. I ran an alignment on your sequences against our antibodies and have come to the conclusion we may have one for guanylyl cyclase beta-1 that has a small chance of working. Please follow this link to the product datasheet. This immunogen information is provided and you can run an alignment against the sequence you have shared with me. While it is not high enough for us to guarantee or recommend with a high likelihood of success, this would be your best option in my opinion and this is a high quality antibody that gets great feedback from our customers in the stated uses and species. Unfortunately for your other targets I was unable to track down any suitable candidates.

Bioinformatics

• Gene Symbol: GUCY1B1