Guanylyl Cyclase beta 1 Antibody

Images

 
Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more
Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Guanylyl Cyclase beta 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCY1B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Guanylyl Cyclase beta 1 Protein (NBP1-89784PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Guanylyl Cyclase beta 1 Antibody

  • EC 4.6.1.2
  • GC-SB3
  • GCS-beta-1
  • GCS-beta-3
  • guanylate cyclase 1, soluble, beta 3
  • guanylate cyclase soluble subunit beta-1
  • Guanylate cyclase soluble subunit beta-3
  • GUC1B3GUCB3
  • GUCSB3GC-S-beta-1
  • GUCY1B1
  • Soluble guanylate cyclase small subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37401
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89784
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Guanylyl Cyclase beta 1 Antibody (NBP1-89784) (0)

There are no publications for Guanylyl Cyclase beta 1 Antibody (NBP1-89784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Guanylyl Cyclase beta 1 Antibody (NBP1-89784) (0)

There are no reviews for Guanylyl Cyclase beta 1 Antibody (NBP1-89784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Guanylyl Cyclase beta 1 Antibody (NBP1-89784). (Showing 1 - 1 of 1 FAQ).

  1. We are searching for antibodies raised against soluble guanylyl cyclase and NMDA-receptor. Both antibodies would be used on a mollusk (Helix pomatia). In some cases we could not find sequence information on your antibodies target. We can give you the sequences of both proteins described in a mollusk (Lymnaea) standing closest to that our target species. I hope some of your immunogen sequences used for antibody production will match with high confidence with a part of these protein sequences. Would you so kind as to help us finding the most promising antibody from your palette.
    • In regards to your inquiry, unfortunately with this being an organism that is not commonly studied by our researchers we don't have many products that match up with this one. I ran an alignment on your sequences against our antibodies and have come to the conclusion we may have one for guanylyl cyclase beta-1 that has a small chance of working. Please follow this link to the product datasheet. This immunogen information is provided and you can run an alignment against the sequence you have shared with me. While it is not high enough for us to guarantee or recommend with a high likelihood of success, this would be your best option in my opinion and this is a high quality antibody that gets great feedback from our customers in the stated uses and species. Unfortunately for your other targets I was unable to track down any suitable candidates.

Secondary Antibodies

 

Isotype Controls

Additional Guanylyl Cyclase beta 1 Products

Bioinformatics Tool for Guanylyl Cyclase beta 1 Antibody (NBP1-89784)

Discover related pathways, diseases and genes to Guanylyl Cyclase beta 1 Antibody (NBP1-89784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Guanylyl Cyclase beta 1 Antibody (NBP1-89784)

Discover more about diseases related to Guanylyl Cyclase beta 1 Antibody (NBP1-89784).
 

Pathways for Guanylyl Cyclase beta 1 Antibody (NBP1-89784)

View related products by pathway.

PTMs for Guanylyl Cyclase beta 1 Antibody (NBP1-89784)

Learn more about PTMs related to Guanylyl Cyclase beta 1 Antibody (NBP1-89784).

Blogs on Guanylyl Cyclase beta 1

There are no specific blogs for Guanylyl Cyclase beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Guanylyl Cyclase beta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCY1B3