PDE5A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PDE5A Antibody [NBP1-86139] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PDE5A Antibody [NBP1-86139] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PDE5A Antibody [NBP1-86139] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE5A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDE5A Protein (NBP1-86139PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE5A Antibody

  • CGB-PDE
  • cGMP-binding cGMP-specific 3'-5'-cyclic nucleotide phosphodiesterase
  • cGMP-binding cGMP-specific phosphodiesterase
  • cGMP-specific 3'-5'-cyclic phosphodiesterase
  • cGMP-specific phosphodiesterase type 5A
  • CN5A
  • EC 3.1.4
  • EC 3.1.4.35
  • PDE5
  • phosphodiesterase 5A, cGMP-specific
  • phosphodiesterase isozyme 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDE5A Antibody (NBP1-86139) (0)

There are no publications for PDE5A Antibody (NBP1-86139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE5A Antibody (NBP1-86139) (0)

There are no reviews for PDE5A Antibody (NBP1-86139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDE5A Antibody (NBP1-86139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE5A Products

Bioinformatics Tool for PDE5A Antibody (NBP1-86139)

Discover related pathways, diseases and genes to PDE5A Antibody (NBP1-86139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE5A Antibody (NBP1-86139)

Discover more about diseases related to PDE5A Antibody (NBP1-86139).
 

Pathways for PDE5A Antibody (NBP1-86139)

View related products by pathway.

PTMs for PDE5A Antibody (NBP1-86139)

Learn more about PTMs related to PDE5A Antibody (NBP1-86139).
 

Research Areas for PDE5A Antibody (NBP1-86139)

Find related products by research area.

Blogs on PDE5A

There are no specific blogs for PDE5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE5A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE5A