GTP binding protein era homolog Antibody

Images

 
Western Blot: GTP binding protein era homolog Antibody [NBP1-89703] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GTP binding protein era homolog Antibody [NBP1-89703] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: GTP binding protein era homolog Antibody [NBP1-89703] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTP binding protein era homolog Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTP binding protein era homolog Protein (NBP1-89703PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTP binding protein era homolog Antibody

  • CEGA
  • Conserved ERA-like GTPase
  • Era (E. coli G-protein homolog)-like 1
  • Era G-protein-like 1 (E. coli)
  • ERA
  • ERAL1A
  • ERA-like protein 1
  • ERA-W
  • GTPase Era, mitochondrial
  • GTPase, human homolog of E. coli essential cell cycle protein Era
  • GTP-binding protein era homolog
  • hERA
  • H-ERA
  • HERA-A
  • HERA-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-07799
Species: Hu
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
7570-GH
Species: Hu
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89703
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GTP binding protein era homolog Antibody (NBP1-89703) (0)

There are no publications for GTP binding protein era homolog Antibody (NBP1-89703).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTP binding protein era homolog Antibody (NBP1-89703) (0)

There are no reviews for GTP binding protein era homolog Antibody (NBP1-89703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTP binding protein era homolog Antibody (NBP1-89703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTP binding protein era homolog Products

Bioinformatics Tool for GTP binding protein era homolog Antibody (NBP1-89703)

Discover related pathways, diseases and genes to GTP binding protein era homolog Antibody (NBP1-89703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTP binding protein era homolog Antibody (NBP1-89703)

Discover more about diseases related to GTP binding protein era homolog Antibody (NBP1-89703).
 

Pathways for GTP binding protein era homolog Antibody (NBP1-89703)

View related products by pathway.

Blogs on GTP binding protein era homolog

There are no specific blogs for GTP binding protein era homolog, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTP binding protein era homolog Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERAL1