GTP binding protein era homolog Antibody

Images

 
Western Blot: GTP binding protein era homolog Antibody [NBP1-57433] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

GTP binding protein era homolog Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ERAL1 (Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the C terminal of ERAL1. Peptide sequence KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERAL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for GTP binding protein era homolog Antibody

  • CEGA
  • Conserved ERA-like GTPase
  • Era (E. coli G-protein homolog)-like 1
  • Era G-protein-like 1 (E. coli)
  • ERA
  • ERAL1A
  • ERA-like protein 1
  • ERA-W
  • GTPase Era, mitochondrial
  • GTPase, human homolog of E. coli essential cell cycle protein Era
  • GTP-binding protein era homolog
  • hERA
  • H-ERA
  • HERA-A
  • HERA-B

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GTP binding protein era homolog Antibody (NBP1-57433) (0)

There are no publications for GTP binding protein era homolog Antibody (NBP1-57433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTP binding protein era homolog Antibody (NBP1-57433) (0)

There are no reviews for GTP binding protein era homolog Antibody (NBP1-57433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTP binding protein era homolog Antibody (NBP1-57433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTP binding protein era homolog Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERAL1
Uniprot