GTP binding protein era homolog Antibody

Western Blot: GTP binding protein era homolog Antibody [NBP1-57433] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GTP binding protein era homolog Antibody Summary

• Immunogen: Synthetic peptides corresponding to ERAL1 (Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the C terminal of ERAL1. Peptide sequence KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERAL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ERAL1 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GTP binding protein era homolog Antibody

• CEGA
• Conserved ERA-like GTPase
• Era (E. coli G-protein homolog)-like 1
• Era G-protein-like 1 (E. coli)
• ERA
• ERAL1A
• ERA-like protein 1
• ERA-W
• GTPase Era, mitochondrial
• GTPase, human homolog of E. coli essential cell cycle protein Era
• GTP-binding protein era homolog
• hERA
• H-ERA
• HERA-A
• HERA-B

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERAL1
• Uniprot:
  • O75616(Human)