GTP binding protein era homolog Antibody - BSA Free

Western Blot: GTP binding protein era homolog Antibody [NBP1-57433] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GTP binding protein era homolog Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ERAL1 (Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the C terminal of ERAL1. Peptide sequence KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERAL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GTP binding protein era homolog Antibody - BSA Free

• CEGA
• Conserved ERA-like GTPase
• Era (E. coli G-protein homolog)-like 1
• Era G-protein-like 1 (E. coli)
• ERA
• ERAL1A
• ERA-like protein 1
• ERA-W
• GTPase Era, mitochondrial
• GTPase, human homolog of E. coli essential cell cycle protein Era
• GTP-binding protein era homolog
• hERA
• H-ERA
• HERA-A
• HERA-B

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERAL1
• Uniprot:
  • O75616(Human)