GTP binding protein era homolog Antibody Summary
Immunogen |
Synthetic peptides corresponding to ERAL1 (Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the C terminal of ERAL1.
Peptide sequence KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ERAL1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This is a rabbit polyclonal antibody against ERAL1 and was validated on Western blot. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS & 2% Sucrose. |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for GTP binding protein era homolog Antibody
Background
The function remains unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Publications for GTP binding protein era homolog Antibody (NBP1-57433) (0)
There are no publications for GTP binding protein era homolog Antibody (NBP1-57433).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GTP binding protein era homolog Antibody (NBP1-57433) (0)
There are no reviews for GTP binding protein era homolog Antibody (NBP1-57433).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GTP binding protein era homolog Antibody (NBP1-57433) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GTP binding protein era homolog Products
Bioinformatics Tool for GTP binding protein era homolog Antibody (NBP1-57433)
Discover related pathways, diseases and genes to GTP binding protein era homolog Antibody (NBP1-57433). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GTP binding protein era homolog Antibody (NBP1-57433)
Discover more about diseases related to GTP binding protein era homolog Antibody (NBP1-57433).
| | Pathways for GTP binding protein era homolog Antibody (NBP1-57433)
View related products by pathway.
|
Blogs on GTP binding protein era homolog