Granulin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Granulin Antibody [NBP1-87325] - Staining of human cell line A-431 shows localization to endoplasmic reticulum, endosomes & lysosomes.
Immunohistochemistry-Paraffin: Granulin Antibody [NBP1-87325] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Granulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Granulin Protein (NBP1-87325PEP)
Publications
Read Publication using NBP1-87325.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Granulin Antibody

  • acrogranin
  • GEP
  • GP88
  • granulin
  • granulin-epithelin
  • granulins
  • PC cell-derived growth factor
  • PCDGF
  • PEPI
  • PGRN
  • proepithelin
  • progranulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB7509
Species: Hu
Applications: WB, IHC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
AF842
Species: Hu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87325
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Granulin Antibody (NBP1-87325)(1)

Reviews for Granulin Antibody (NBP1-87325) (0)

There are no reviews for Granulin Antibody (NBP1-87325). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Granulin Antibody (NBP1-87325) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Granulin Products

Bioinformatics Tool for Granulin Antibody (NBP1-87325)

Discover related pathways, diseases and genes to Granulin Antibody (NBP1-87325). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granulin Antibody (NBP1-87325)

Discover more about diseases related to Granulin Antibody (NBP1-87325).
 

Pathways for Granulin Antibody (NBP1-87325)

View related products by pathway.

PTMs for Granulin Antibody (NBP1-87325)

Learn more about PTMs related to Granulin Antibody (NBP1-87325).
 

Research Areas for Granulin Antibody (NBP1-87325)

Find related products by research area.

Blogs on Granulin

There are no specific blogs for Granulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Granulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRN