PP14/Glycodelin Antibody


Western Blot: PP14/Glycodelin Antibody [NBP1-89782] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: PP14/Glycodelin Antibody [NBP1-89782] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89782] - Staining in human endometrium and prostate tissues using anti-PAEP antibody. Corresponding PAEP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89782] - Staining of human placenta shows cytoplasmic and nuclear positivity in Trophoblasts.
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89782] - Staining of human endometrium shows high expression.
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89782] - Staining of human prostate shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PP14/Glycodelin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQME
Specificity of human PP14/Glycodelin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PP14/Glycodelin Recombinant Protein Antigen (NBP1-89782PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PP14/Glycodelin Antibody

  • alpha uterine protein
  • GdF
  • GdS
  • Glycodelin
  • glycodelin-A
  • glycodelin-F
  • glycodelin-S
  • MGC138509
  • MGC142288
  • PAEP
  • PEP
  • Placental protein 14
  • PP14 protein (placental protein 14)
  • PP14
  • pregnancy-associated endometrial a
  • Pregnancy-associated endometrial alpha-2 globulin
  • pregnancy-associated endometrial alpha-2-globulin
  • progestagen-associated endometrial protein (placental protein 14
  • progestagen-associated endometrial proteinPEG
  • Progesterone-associated endometrial protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PP14/Glycodelin Antibody (NBP1-89782) (0)

There are no publications for PP14/Glycodelin Antibody (NBP1-89782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP14/Glycodelin Antibody (NBP1-89782) (0)

There are no reviews for PP14/Glycodelin Antibody (NBP1-89782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PP14/Glycodelin Antibody (NBP1-89782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PP14/Glycodelin Products

Bioinformatics Tool for PP14/Glycodelin Antibody (NBP1-89782)

Discover related pathways, diseases and genes to PP14/Glycodelin Antibody (NBP1-89782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP14/Glycodelin Antibody (NBP1-89782)

Discover more about diseases related to PP14/Glycodelin Antibody (NBP1-89782).

Pathways for PP14/Glycodelin Antibody (NBP1-89782)

View related products by pathway.

PTMs for PP14/Glycodelin Antibody (NBP1-89782)

Learn more about PTMs related to PP14/Glycodelin Antibody (NBP1-89782).

Blogs on PP14/Glycodelin

There are no specific blogs for PP14/Glycodelin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PP14/Glycodelin Antibody and receive a gift card or discount.


Gene Symbol PAEP