Granulin Antibody - BSA Free

Immunohistochemistry-Paraffin: Granulin Antibody [NBP1-87324] - Staining in human placenta and skeletal muscle tissues . Corresponding GRN RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Granulin Antibody [NBP1-87324] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lysosomes. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Granulin Antibody [NBP1-87324] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Granulin Antibody [NBP1-87324] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Granulin Antibody [NBP1-87324] - Staining of human placenta shows moderate to strong granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Granulin Antibody [NBP1-87324] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in striated muscle fibers.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Granulin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 29511098)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Granulin Protein (NBP1-87324PEP)

Reactivity Notes

Mouse reactivity reported in (PMID: 29511098). Rat (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Granulin Antibody - BSA Free

• acrogranin
• GEP
• GP88
• granulin
• granulin-epithelin
• granulins
• PC cell-derived growth factor
• PCDGF
• PEPI
• PGRN
• proepithelin
• progranulin

Background

Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Granulin Antibody (NBP1-87324)(2)

Publications using NBP1-87324

• Kuang L, Hashimoto K, Huang EJ et al. Frontotemporal dementia nonsense mutation of progranulin rescued by aminoglycosides Hum. Mol. Genet. 2020-01-08 [PMID: 31913476] (ICC/IF, WB, Mouse)
• Nguyen AD, Nguyen TA, Zhang J, et al Murine knockin model for progranulin-deficient frontotemporal dementia with nonsense-mediated mRNA decay Proc Natl Acad Sci USA. 2018-03-06 [PMID: 29511098] (WB, Mouse)

Bioinformatics

• Gene Symbol: GRN