Granulin Antibody (CL5695)

Images

 
Western Blot: Granulin Antibody (CL5695) [NBP2-61425] - Analysis in human cell line PC-3.
Immunohistochemistry-Paraffin: Granulin Antibody (CL5695) [NBP2-61425] - Staining of human skeletal muscle shows absence of positivity in striated muscle fibers as expected (negative control).
Immunohistochemistry-Paraffin: Granulin Antibody (CL5695) [NBP2-61425] - Staining of human endometrium shows moderate granular cytoplasmic immunoreactivity in glandular cells.
Immunohistochemistry-Paraffin: Granulin Antibody (CL5695) [NBP2-61425] - Staining of human liver shows cytoplasmic immunoreactivity in Kupffer cells.
Immunohistochemistry-Paraffin: Granulin Antibody (CL5695) [NBP2-61425] - Staining of human prostate shows moderate granular cytoplasmic immunoreactivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL5695
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Granulin Antibody (CL5695) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL
Epitope
DHQHCCPQGYTCVAE
Specificity
Specificity of human Granulin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
GRN
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Granulin Knockout 293T Cell Lysate

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Granulin Antibody (CL5695)

  • acrogranin
  • GEP
  • GP88
  • granulin
  • granulin-epithelin
  • granulins
  • PC cell-derived growth factor
  • PCDGF
  • PEPI
  • PGRN
  • proepithelin
  • progranulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF7509
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-89781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
AF1436
Species: Mu
Applications: WB
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
7270-IL/CF
Species: Hu
NB100-56749
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Granulin Antibody (NBP2-61425) (0)

There are no publications for Granulin Antibody (NBP2-61425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granulin Antibody (NBP2-61425) (0)

There are no reviews for Granulin Antibody (NBP2-61425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granulin Antibody (NBP2-61425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Granulin Products

Bioinformatics Tool for Granulin Antibody (NBP2-61425)

Discover related pathways, diseases and genes to Granulin Antibody (NBP2-61425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granulin Antibody (NBP2-61425)

Discover more about diseases related to Granulin Antibody (NBP2-61425).
 

Pathways for Granulin Antibody (NBP2-61425)

View related products by pathway.

PTMs for Granulin Antibody (NBP2-61425)

Learn more about PTMs related to Granulin Antibody (NBP2-61425).
 

Research Areas for Granulin Antibody (NBP2-61425)

Find related products by research area.

Blogs on Granulin

There are no specific blogs for Granulin, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Granulin Antibody (CL5695) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRN
COVID-19 update