GOLPH3 Antibody - BSA Free

Immunohistochemistry: GOLPH3 Antibody [NBP1-81804] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GOLPH3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GOLPH3 Antibody - BSA Free (NBP1-81804) is a polyclonal antibody validated for use in IHC. Anti-GOLPH3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOLPH3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: IHC reported in scientific literature (PMID: 23172368). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GOLPH3 Protein (NBP1-81804PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GOLPH3 Antibody - BSA Free

• Coat protein GPP34
• FLJ90675
• golgi phosphoprotein 3 (coat-protein)
• Golgi phosphoprotein 3
• golgi protein
• golgi-associated protein
• GOPP1
• GPP34coat-protein
• MIDASgolgi peripheral membrane protein 1, 34 kDa
• Mitochondrial DNA absence factor

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GOLPH3 Antibody (NBP1-81804)(1)

Publication using NBP1-81804

• Sotgia F, Whitaker-Menezes D, Martinez-Outschoorn UE et al. Mitochondria fuel breast cancer metabolism: Fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle 2012-12-01 [PMID: 23172368] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: GOLPH3