GOLPH3 Antibody

Images

 
Immunohistochemistry: GOLPH3 Antibody [NBP1-81804] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GOLPH3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Specificity
Specificity of human, mouse, rat GOLPH3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GOLPH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GOLPH3 Protein (NBP1-81804PEP)
Publications
Read Publication using
NBP1-81804 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GOLPH3 Antibody

  • Coat protein GPP34
  • FLJ90675
  • golgi phosphoprotein 3 (coat-protein)
  • Golgi phosphoprotein 3
  • golgi protein
  • golgi-associated protein
  • GOPP1
  • GPP34coat-protein
  • MIDASgolgi peripheral membrane protein 1, 34 kDa
  • Mitochondrial DNA absence factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-50627
Species: Hu, Mu
Applications: WB, ICC/IF, KO
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
NBP2-22321
Species: Hu
Applications: WB, IP, IF
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1031
Species: Hu
Applications: WB, IP, ICC
H00064746-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-412
Species: Hu, Mu, Rt, Bv, Ca, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for GOLPH3 Antibody (NBP1-81804)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GOLPH3 Antibody (NBP1-81804) (0)

There are no reviews for GOLPH3 Antibody (NBP1-81804). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GOLPH3 Antibody (NBP1-81804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GOLPH3 Antibody (NBP1-81804)

Discover related pathways, diseases and genes to GOLPH3 Antibody (NBP1-81804). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLPH3 Antibody (NBP1-81804)

Discover more about diseases related to GOLPH3 Antibody (NBP1-81804).
 

Pathways for GOLPH3 Antibody (NBP1-81804)

View related products by pathway.

PTMs for GOLPH3 Antibody (NBP1-81804)

Learn more about PTMs related to GOLPH3 Antibody (NBP1-81804).
 

Research Areas for GOLPH3 Antibody (NBP1-81804)

Find related products by research area.

Blogs on GOLPH3

There are no specific blogs for GOLPH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GOLPH3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLPH3