TATA Element Modulatory Factor 1 Antibody

Images

 
Western Blot: TATA Element Modulatory Factor 1 Antibody [NBP1-90117] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: TATA Element Modulatory Factor 1 Antibody [NBP1-90117] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TATA Element Modulatory Factor 1 Antibody [NBP1-90117] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
Western Blot: TATA Element Modulatory Factor 1 Antibody [NBP1-90117] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-568

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TATA Element Modulatory Factor 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSTTSDIEVLDHESVISESSASSRQETTDSKSSLHLMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSGKGYALVPIIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAEMEESG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TATA Element Modulatory Factor 1 Protein (NBP1-90117PEP)
Publications
Read Publications using
NBP1-90117 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22553199)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TATA Element Modulatory Factor 1 Antibody

  • TATA element modulatory factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
AF5626
Species: Hu
Applications: WB, ICC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89021
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1744
Species: Hu
Applications: IHC-P
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-20089
Species: Hu
Applications: WB, ICC/IF
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TATA Element Modulatory Factor 1 Antibody (NBP1-90117)(3)

Reviews for TATA Element Modulatory Factor 1 Antibody (NBP1-90117) (0)

There are no reviews for TATA Element Modulatory Factor 1 Antibody (NBP1-90117). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TATA Element Modulatory Factor 1 Antibody (NBP1-90117) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TATA Element Modulatory Factor 1 Products

Bioinformatics Tool for TATA Element Modulatory Factor 1 Antibody (NBP1-90117)

Discover related pathways, diseases and genes to TATA Element Modulatory Factor 1 Antibody (NBP1-90117). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TATA Element Modulatory Factor 1 Antibody (NBP1-90117)

Discover more about diseases related to TATA Element Modulatory Factor 1 Antibody (NBP1-90117).
 

Pathways for TATA Element Modulatory Factor 1 Antibody (NBP1-90117)

View related products by pathway.

PTMs for TATA Element Modulatory Factor 1 Antibody (NBP1-90117)

Learn more about PTMs related to TATA Element Modulatory Factor 1 Antibody (NBP1-90117).

Blogs on TATA Element Modulatory Factor 1

There are no specific blogs for TATA Element Modulatory Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TATA Element Modulatory Factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMF1