GOLPH4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GOLPH4 Antibody [NBP1-91954] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human skin shows low expression as expected.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human liver.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human cerebral cortex, liver, skin and small intestine using Anti-GOLIM4 antibody NBP1-91954 (A) shows similar protein distribution across ...read more
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Analysis in human small intestine and skin tissues using NBP1-91954 antibody. Corresponding GOLIM4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human small intestine shows strong positivity in Golgi apparatus in glandular cells.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons and glial cells.
Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91954] - Staining of human skin shows moderate granular cytoplasmic positivity in a small subset of squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GOLPH4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAED
Marker
Golgi Apparatus Marker
Specificity
Specificity of human GOLPH4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GOLIM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GOLPH4 Protein (NBP1-91954PEP)
Publications
Read Publication using NBP1-91954.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GOLPH4 Antibody

  • GIMPc
  • GIMPCcis
  • golgi integral membrane protein 4
  • Golgi phosphoprotein 4130 kDa golgi-localized phosphoprotein
  • Golgi phosphoprotein of 130 kDa
  • GPP130Golgi-localized phosphoprotein of 130 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-50627
Species: Hu, Mu
Applications: WB, ICC/IF, KO
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22321
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-49643
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, Flow-IC, KO
NBP1-83352
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
H00009527-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85571
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00010491-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-83996
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1002
Species: Hu
Applications: WB, PEP-ELISA, IF

Publications for GOLPH4 Antibody (NBP1-91954)(1)

Reviews for GOLPH4 Antibody (NBP1-91954) (0)

There are no reviews for GOLPH4 Antibody (NBP1-91954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GOLPH4 Antibody (NBP1-91954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GOLPH4 Products

Bioinformatics Tool for GOLPH4 Antibody (NBP1-91954)

Discover related pathways, diseases and genes to GOLPH4 Antibody (NBP1-91954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLPH4 Antibody (NBP1-91954)

Discover more about diseases related to GOLPH4 Antibody (NBP1-91954).
 

Pathways for GOLPH4 Antibody (NBP1-91954)

View related products by pathway.

PTMs for GOLPH4 Antibody (NBP1-91954)

Learn more about PTMs related to GOLPH4 Antibody (NBP1-91954).
 

Research Areas for GOLPH4 Antibody (NBP1-91954)

Find related products by research area.

Blogs on GOLPH4

There are no specific blogs for GOLPH4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GOLPH4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLIM4