Glycophorin A Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GYPA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Glycophorin A Antibody - BSA Free
Background
Glycophorins A (GPA) and B (GPB) are single pass membrane sialoglycoproteins. GPA is the carrier of blood group M and N specificities, while GPB accounts for S and U specificities. GPA and GPB provide the cells with a large mucin like surface and it has been suggested this provides a barrier to cell fusion, so minimizing aggregation between red blood cells in the circulation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Publications for Glycophorin A Antibody (NBP1-85775) (0)
There are no publications for Glycophorin A Antibody (NBP1-85775).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glycophorin A Antibody (NBP1-85775) (0)
There are no reviews for Glycophorin A Antibody (NBP1-85775).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Glycophorin A Antibody (NBP1-85775) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glycophorin A Products
Research Areas for Glycophorin A Antibody (NBP1-85775)
Find related products by research area.
|
Blogs on Glycophorin A