Glycerol 3 Phosphate Dehydrogenase Antibody


Western Blot: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-55332] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Glycerol 3 Phosphate Dehydrogenase Antibody Summary

Synthetic peptides corresponding to GPD1(glycerol-3-phosphate dehydrogenase 1 (soluble)) The peptide sequence was selected from the middle region of GPD1. Peptide sequence TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GPD1 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glycerol 3 Phosphate Dehydrogenase Antibody

  • EC 1.1.1
  • EC
  • FLJ26652
  • glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
  • glycerol-3-phosphate dehydrogenase 1 (soluble)
  • glycerol-3-phosphate dehydrogenase, soluble
  • GPD-C
  • GPDH-C


GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332) (0)

There are no publications for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332) (0)

There are no reviews for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Glycerol 3 Phosphate Dehydrogenase Products

Bioinformatics Tool for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332)

Discover related pathways, diseases and genes to Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332)

Discover more about diseases related to Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332).

Pathways for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332)

View related products by pathway.

PTMs for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332)

Learn more about PTMs related to Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-55332).

Blogs on Glycerol 3 Phosphate Dehydrogenase

There are no specific blogs for Glycerol 3 Phosphate Dehydrogenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glycerol 3 Phosphate Dehydrogenase Antibody and receive a gift card or discount.


Gene Symbol GPD1