GPD2 Antibody


Western Blot: GPD2 Antibody [NBP1-86121] - Analysis in human cell line CACO-2.
Immunohistochemistry-Paraffin: GPD2 Antibody [NBP1-86121] - Staining in human parathyroid gland and liver tissues using anti-GPD2 antibody. Corresponding GPD2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GPD2 Antibody [NBP1-86121] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Immunohistochemistry-Paraffin: GPD2 Antibody [NBP1-86121] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: GPD2 Antibody [NBP1-86121] - Staining of human parathyroid gland shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GPD2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEFDILVIGGGATGSG
Specificity of human GPD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPD2 Protein (NBP1-86121PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GPD2 Antibody

  • EC
  • GDH2
  • glycerol-3-phosphate dehydrogenase 2 (mitochondrial)
  • GPDM
  • GPD-M
  • mGPDH
  • mitochondrial glycerophosphate dehydrogenase
  • mitochondrial
  • mtGPD


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P

Publications for GPD2 Antibody (NBP1-86121) (0)

There are no publications for GPD2 Antibody (NBP1-86121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPD2 Antibody (NBP1-86121) (0)

There are no reviews for GPD2 Antibody (NBP1-86121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPD2 Antibody (NBP1-86121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPD2 Products

Bioinformatics Tool for GPD2 Antibody (NBP1-86121)

Discover related pathways, diseases and genes to GPD2 Antibody (NBP1-86121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPD2 Antibody (NBP1-86121)

Discover more about diseases related to GPD2 Antibody (NBP1-86121).

Pathways for GPD2 Antibody (NBP1-86121)

View related products by pathway.

PTMs for GPD2 Antibody (NBP1-86121)

Learn more about PTMs related to GPD2 Antibody (NBP1-86121).

Research Areas for GPD2 Antibody (NBP1-86121)

Find related products by research area.

Blogs on GPD2

There are no specific blogs for GPD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPD2 Antibody and receive a gift card or discount.


Gene Symbol GPD2