GPD2 Antibody - BSA Free

Western Blot: GPD2 Antibody [NBP1-86121] - Staining of human colon, liver, parathyroid gland and skin using Anti-GPD2 antibody NBP1-86121 (A) shows similar protein distribution across tissues to independent antibody NBP2-38542 (B).

Western Blot: GPD2 Antibody [NBP1-86121] - Analysis using Anti-GPD2 antibody NBP1-86121 (A) shows similar pattern to independent antibody NBP2-38542 (B).

Staining of human liver shows negative to very weak cytoplasmic granular positivity in hepatocytes.

Staining of human colon shows strong cytoplasmic granular positivity in glandular cells.

Staining of human gastrointestinal, liver, prostate and squamous epithelia using Anti-GPD2 antibody NBP1-86121 (A) shows similar protein distribution across tissues to independent antibody NBP2-38542 (B).

Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.

Staining of human skin shows strong cytoplasmic granular positivity in squamous epithelial cells.

Staining of human parathyroid gland shows strong cytoplasmic granular positivity in glandular cells.

Immunohistochemistry analysis in human parathyroid gland and liver tissues using HPA008012 antibody. Corresponding GPD2 RNA-seq data are presented for the same tissues.

Analysis in human cell line CACO-2.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPD2 Antibody - BSA Free (NBP1-86121) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEFDILVIGGGATGSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPD2 Protein (NBP1-86121PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPD2 Antibody - BSA Free

• EC 1.1.5.3
• GDH2
• glycerol-3-phosphate dehydrogenase 2 (mitochondrial)
• GPD2
• GPDH-M
• GPDM
• GPD-M
• mGDH
• mGPDH
• mitochondrial glycerophosphate dehydrogenase
• mitochondrial
• mtGPD

Background

Mitochondrial glycerophosphate dehydrogenase (EC 1.1.99.5), or GPD2, is located on the outer surface of the inner mitochondrial membrane and catalyzes the unidirectional conversion of glycerol-3-phosphate (G-3-P) to dihydroxyacetone phosphate (DHAP) with concomitant reduction of the enzyme-bound FAD. Together with a cytosolic NAD-linked GPD (GPD1; MIM 138420), GPD2 forms the glycerol phosphate shuttle, which uses the interconversion of G-3-P and DHAP to transfer reducing equivalents into mitochondria, resulting in the reoxidation of NADH formed during glycolysis.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPD2