Glutamine Synthetase Antibody

Images

 
Western Blot: Glutamine Synthetase Antibody [NBP1-89767] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: Glutamine Synthetase Antibody [NBP1-89767] - Staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: Glutamine Synthetase Antibody [NBP1-89767] - Staining of human hippocampus shows distinct positivity in astrocyte like cells.
Western Blot: Glutamine Synthetase Antibody [NBP1-89767] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: Glutamine Synthetase Antibody [NBP1-89767] - Staining of human cell line A-431 shows positivity in cytoplasm and golgi apparatus.
Immunohistochemistry-Paraffin: Glutamine Synthetase Antibody [NBP1-89767] - Staining of human stomach shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunofluorescence: Glutamine Synthetase Antibody [NBP1-89767] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutamine Synthetase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLUL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glutamine Synthetase Protein (NBP1-89767PEP)
Publications
Read Publication using NBP1-89767.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutamine Synthetase Antibody

  • cell proliferation-inducing protein 59
  • EC 4.1.1.15
  • EC 6.3.1.2
  • GLNSPIG59
  • Glutamate decarboxylase
  • glutamate-ammonia ligase (glutamine synthase)
  • glutamate-ammonia ligase
  • Glutamate--ammonia ligase
  • glutamine synthase
  • glutamine synthetase
  • GS
  • PIG43
  • proliferation-inducing protein 43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
MAB7906
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-89767
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for Glutamine Synthetase Antibody (NBP1-89767)(1)

Reviews for Glutamine Synthetase Antibody (NBP1-89767) (0)

There are no reviews for Glutamine Synthetase Antibody (NBP1-89767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutamine Synthetase Antibody (NBP1-89767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutamine Synthetase Products

Bioinformatics Tool for Glutamine Synthetase Antibody (NBP1-89767)

Discover related pathways, diseases and genes to Glutamine Synthetase Antibody (NBP1-89767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutamine Synthetase Antibody (NBP1-89767)

Discover more about diseases related to Glutamine Synthetase Antibody (NBP1-89767).
 

Pathways for Glutamine Synthetase Antibody (NBP1-89767)

View related products by pathway.

PTMs for Glutamine Synthetase Antibody (NBP1-89767)

Learn more about PTMs related to Glutamine Synthetase Antibody (NBP1-89767).
 

Research Areas for Glutamine Synthetase Antibody (NBP1-89767)

Find related products by research area.

Blogs on Glutamine Synthetase

There are no specific blogs for Glutamine Synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutamine Synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLUL