Glutaminase Antibody (6E12)

Images

 
Sandwich ELISA: Glutaminase Antibody (6E12) [H00002744-M05] - Detection limit for recombinant GST tagged GLS is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
6E12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glutaminase Antibody (6E12) Summary

Immunogen
GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Specificity
GLS - glutaminase (6E12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GLS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glutaminase Antibody (6E12)

  • AAD20
  • EC 3.5.1.2
  • GLS
  • GLS1DKFZp686O15119
  • glutaminase C
  • glutaminase kidney isoform, mitochondrial
  • Glutaminase
  • glutaminase, phosphate-activated
  • K-Glutaminase
  • KIAA0838FLJ10358
  • L-Glutamine Amidohydrolase

Background

Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008833-M01
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, S-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16679
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00030851-M01
Species: Hu
Applications: ELISA, S-ELISA, Simple Western, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00002744-M05
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Glutaminase Antibody (H00002744-M05) (0)

There are no publications for Glutaminase Antibody (H00002744-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutaminase Antibody (H00002744-M05) (0)

There are no reviews for Glutaminase Antibody (H00002744-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutaminase Antibody (H00002744-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutaminase Products

Bioinformatics Tool for Glutaminase Antibody (H00002744-M05)

Discover related pathways, diseases and genes to Glutaminase Antibody (H00002744-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutaminase Antibody (H00002744-M05)

Discover more about diseases related to Glutaminase Antibody (H00002744-M05).
 

Pathways for Glutaminase Antibody (H00002744-M05)

View related products by pathway.

PTMs for Glutaminase Antibody (H00002744-M05)

Learn more about PTMs related to Glutaminase Antibody (H00002744-M05).
 

Research Areas for Glutaminase Antibody (H00002744-M05)

Find related products by research area.

Blogs on Glutaminase

There are no specific blogs for Glutaminase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutaminase Antibody (6E12) and receive a gift card or discount.

Bioinformatics

Gene Symbol GLS
Entrez
Uniprot