Glutaminase Antibody (5C4)

Western Blot: Glutaminase Antibody (5C4) [H00002744-M01] - Western Blot analysis of GLS expression in Hela NE ( Cat # L013V3 ).

Immunocytochemistry/Immunofluorescence: Glutaminase Antibody (5C4) [H00002744-M01] - Analysis of monoclonal antibody to GLS on HeLa cell. Antibody concentration 10 ug/ml.

ELISA: Glutaminase Antibody (5C4) [H00002744-M01] - Detection limit for recombinant GST tagged GLS is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 5C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Glutaminase Antibody (5C4) Summary

• Immunogen: GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
• Specificity: GLS - glutaminase
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GLS
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glutaminase Antibody (5C4)

• AAD20
• EC 3.5.1.2
• GLS
• GLS1DKFZp686O15119
• glutaminase C
• glutaminase kidney isoform, mitochondrial
• Glutaminase
• glutaminase, phosphate-activated
• K-Glutaminase
• KIAA0838FLJ10358
• L-Glutamine Amidohydrolase

Background

Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glutaminase Antibody (H00002744-M01)(6)

Publications using H00002744-M01

• Polletta L, Vernucci E, Carnevale I et al. SIRT5 regulation of ammonia-induced autophagy and mitophagy Autophagy. 2015 Feb 20 [PMID: 25700560]
• Hida H, Mouri A, Ando Y et al. Combination of neonatal PolyI:C and adolescent phencyclidine treatments is required to induce behavioral abnormalities with overexpression of GLAST in adult mice. Behav Brain Res. 2013 Sep 20 [PMID: 24060653]
• Reynolds MR, Lane AN, Robertson B et al. Control of glutamine metabolism by the tumor suppressor Rb. Oncogene. 2013 Jan 28 [PMID: 23353822]
• Cassago A, Ferreira AP, Ferreira IM et al. Mitochondrial localization and structure-based phosphate activation mechanism of Glutaminase C with implications for cancer metabolism. Proc Natl Acad Sci U S A. 2012 Jan 06 [PMID: 22228304]
• Cole JT, Mitala CM, Kundu S et al. Dietary branched chain amino acids ameliorate injury-induced cognitive impairment. Proc Natl Acad Sci U S A. 2009 Dec 7. [PMID: 19995960]
• Unterluggauer H, Mazurek S, Lener B et al. Premature senescence of human endothelial cells induced by inhibition of glutaminase. Biogerontology. 2008 Mar 04 [PMID: 18317946]

Bioinformatics

• Gene Symbol: GLS
• Entrez:
  • 2744(Human)
• OMIM:
  • 138280(Human)
• Uniprot:
  • NP_055720(Human)