Glucose 6 Phosphate Dehydrogenase Antibody

Images

 
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human bone marrow shows strong positivity in subsets of hematopoietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glucose 6 Phosphate Dehydrogenase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKP
Marker
Cytosol Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
G6PD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glucose 6 Phosphate Dehydrogenase Protein (NBP1-89805PEP)
Publications
Read Publications using NBP1-89805.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20647035)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glucose 6 Phosphate Dehydrogenase Antibody

  • G6PD
  • G6PD1EC 1.1.1.49
  • glucose-6-phosphate dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54755
Species: Hu
Applications: WB
NBP2-34980
Species: Hu
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805)(2)

Reviews for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805) (0)

There are no reviews for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucose 6 Phosphate Dehydrogenase Products

Bioinformatics Tool for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805)

Discover related pathways, diseases and genes to Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805)

Discover more about diseases related to Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805).
 

Pathways for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805)

View related products by pathway.

PTMs for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805)

Learn more about PTMs related to Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805).
 

Research Areas for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805)

Find related products by research area.

Blogs on Glucose 6 Phosphate Dehydrogenase

There are no specific blogs for Glucose 6 Phosphate Dehydrogenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucose 6 Phosphate Dehydrogenase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol G6PD