Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9) Summary
| Description |
Novus Biologicals Rabbit Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9) (NBP3-15359) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Glucose 6 Phosphate Dehydrogenase (P11413). VYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVG |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
G6PD |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Glucose 6 Phosphate Dehydrogenase Antibody (6V8O9)
Background
Glucose-6-phosphate dehydrogenase (G6PD) is a cytosolic enzyme that catalyzes the conversion of glucose-6-phosphate into 6-phosphgluconolactone and maintains the levels of the electron donor, NADPH. G6PD is an x-linked housekeeping gene whose deficiency can result in neonatal jaundice, acute hemolysis, or chronic non-spherocytic hemolytic anemia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC-P
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for Glucose 6 Phosphate Dehydrogenase Antibody (NBP3-15359) (0)
There are no publications for Glucose 6 Phosphate Dehydrogenase Antibody (NBP3-15359).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glucose 6 Phosphate Dehydrogenase Antibody (NBP3-15359) (0)
There are no reviews for Glucose 6 Phosphate Dehydrogenase Antibody (NBP3-15359).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glucose 6 Phosphate Dehydrogenase Antibody (NBP3-15359) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glucose 6 Phosphate Dehydrogenase Products
Research Areas for Glucose 6 Phosphate Dehydrogenase Antibody (NBP3-15359)
Find related products by research area.
|
Blogs on Glucose 6 Phosphate Dehydrogenase