GILT/IFI30 Antibody

Images

 
Western Blot: GILT/IFI30 Antibody [NBP1-83366] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/ Immunofluorescence: GILT/IFI30 Antibody [NBP1-83366] - Staining of human cell line A-431 shows localization to cell junctions & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GILT/IFI30 Antibody [NBP1-83366] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of lymphoid cells outside reaction centra.
Western Blot: GILT/IFI30 Antibody [NBP1-83366] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GILT/IFI30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFI30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25333930). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GILT/IFI30 Protein (NBP1-83366PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-83366 in the following applications:

Publications
Read Publication using
NBP1-83366 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25333930). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GILT/IFI30 Antibody

  • EC 1.8
  • Gamma-interferon-inducible protein IP-30
  • GILT
  • GILTgamma-interferon-inducible lysosomal thiol reductase
  • IFI30
  • IFI-30
  • interferon, gamma-inducible protein 30
  • IP30
  • IP30interferon gamma-inducible protein 30 preproprotein
  • Legumaturain
  • MGC32056

Background

IFI30 is encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-57531
Species: Hu
Applications: IHC, IHC-P, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
285-IF
Species: Hu
Applications: BA
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004154-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
DLP00
Species: Hu
Applications: ELISA

Publications for GILT/IFI30 Antibody (NBP1-83366)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for GILT/IFI30 Antibody (NBP1-83366) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-83366:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GILT/IFI30 NBP1-83366
Enlarge
5
reviewed by:
Zeyuan Zhang
WB Mouse 09/15/2020
View

Summary

ApplicationWestern Blot
Sample TestedAdult Mouse Lung Tissue,Brown adipose tissue,Liver,white adipose tissue
SpeciesMouse
LotA107115

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GILT/IFI30 Antibody (NBP1-83366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GILT/IFI30 Products

Bioinformatics Tool for GILT/IFI30 Antibody (NBP1-83366)

Discover related pathways, diseases and genes to GILT/IFI30 Antibody (NBP1-83366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GILT/IFI30 Antibody (NBP1-83366)

Discover more about diseases related to GILT/IFI30 Antibody (NBP1-83366).
 

Pathways for GILT/IFI30 Antibody (NBP1-83366)

View related products by pathway.

PTMs for GILT/IFI30 Antibody (NBP1-83366)

Learn more about PTMs related to GILT/IFI30 Antibody (NBP1-83366).
 

Research Areas for GILT/IFI30 Antibody (NBP1-83366)

Find related products by research area.

Blogs on GILT/IFI30

There are no specific blogs for GILT/IFI30, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Zeyuan Zhang
09/15/2020
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol IFI30