GILT/IFI30 Antibody

Images

 
Western Blot: GILT/IFI30 Antibody [NBP1-83366] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: GILT/IFI30 Antibody [NBP1-83366] - Staining of human cell line A-431 shows localization to cell junctions & vesicles.
Immunohistochemistry-Paraffin: GILT/IFI30 Antibody [NBP1-83366] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GILT/IFI30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFI30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GILT/IFI30 Protein (NBP1-83366PEP)
Publications
Read Publication using
NBP1-83366 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25333930).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GILT/IFI30 Antibody

  • EC 1.8
  • Gamma-interferon-inducible protein IP-30
  • GILT
  • GILTgamma-interferon-inducible lysosomal thiol reductase
  • IFI30
  • IFI-30
  • interferon, gamma-inducible protein 30
  • IP30
  • IP30interferon gamma-inducible protein 30 preproprotein
  • Legumaturain
  • MGC32056

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-87296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-83366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GILT/IFI30 Antibody (NBP1-83366)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GILT/IFI30 Antibody (NBP1-83366) (0)

There are no reviews for GILT/IFI30 Antibody (NBP1-83366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GILT/IFI30 Antibody (NBP1-83366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GILT/IFI30 Products

Bioinformatics Tool for GILT/IFI30 Antibody (NBP1-83366)

Discover related pathways, diseases and genes to GILT/IFI30 Antibody (NBP1-83366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GILT/IFI30 Antibody (NBP1-83366)

Discover more about diseases related to GILT/IFI30 Antibody (NBP1-83366).
 

Pathways for GILT/IFI30 Antibody (NBP1-83366)

View related products by pathway.

PTMs for GILT/IFI30 Antibody (NBP1-83366)

Learn more about PTMs related to GILT/IFI30 Antibody (NBP1-83366).
 

Research Areas for GILT/IFI30 Antibody (NBP1-83366)

Find related products by research area.

Blogs on GILT/IFI30

There are no specific blogs for GILT/IFI30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GILT/IFI30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI30
Entrez