Muscleblind-like 1 Antibody (3E7)

Images

 
Western Blot: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - MBNL1 monoclonal antibody (M02), clone 3E7 Analysis of MBNL1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 0.75 ug/ml.
ELISA: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Detection limit for recombinant GST tagged MBNL1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
3E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Muscleblind-like 1 Antibody (3E7) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
MBNL1 (AAH43493, 1 a.a. ~ 382 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLIRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Specificity
MBNL1 - muscleblind-like (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MBNL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00004154-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Muscleblind-like 1 Antibody (3E7)

  • DKFZp686P06174
  • EXP40
  • EXP42
  • EXPKIAA0428EXP35
  • MBNL
  • muscleblind (Drosophila)-like
  • muscleblind-like (Drosophila)
  • muscleblind-like protein 1
  • Triplet-expansion RNA-binding protein

Background

Several important human diseases are associated with expansion of polynucleotide sequences, in most cases trinucleotide repeats. Myotonic dystrophy (DM1) is one of these diseases, and is associated with increases in the number of CTG repeats in the UTR of the gene encoding myotonin (a.k.a. DM Kinase, DMK or myotonin-Protein Kinase), a ser/thr kinase expressed specifically in muscle. Mammalian genomes contain three muscleblind-like proteins, generally referred to as MBNL1, MBNL2 and MBNL3, and all three were found to associate with long double stranded CUG RNA repeats, thus, being triplet repeat expansion dsRNA-binding proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Muscleblind-like 1 Antibody (H00004154-M02)(3)

Reviews for Muscleblind-like 1 Antibody (H00004154-M02) (0)

There are no reviews for Muscleblind-like 1 Antibody (H00004154-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Muscleblind-like 1 Antibody (H00004154-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Muscleblind-like 1 Products

Research Areas for Muscleblind-like 1 Antibody (H00004154-M02)

Find related products by research area.

Blogs on Muscleblind-like 1

There are no specific blogs for Muscleblind-like 1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Muscleblind-like 1 Antibody (3E7) and receive a gift card or discount.

Bioinformatics

Gene Symbol MBNL1
Entrez
OMIM
Uniprot