Muscleblind-like 1 Antibody (3E7)

Images

 
Western Blot: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - MBNL1 monoclonal antibody (M02), clone 3E7 Analysis of MBNL1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 0.75 ug/ml.
ELISA: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Detection limit for recombinant GST tagged MBNL1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Muscleblind-like 1 Antibody (3E7) Summary

Immunogen
MBNL1 (AAH43493, 1 a.a. ~ 382 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLIRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Specificity
MBNL1 - muscleblind-like (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MBNL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00004154-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Muscleblind-like 1 Antibody (3E7)

  • DKFZp686P06174
  • EXP40
  • EXP42
  • EXPKIAA0428EXP35
  • MBNL
  • muscleblind (Drosophila)-like
  • muscleblind-like (Drosophila)
  • muscleblind-like protein 1
  • Triplet-expansion RNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6967
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-57531
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-60616
Species: Hu
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31225
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-79451
Species: Hu
Applications: WB
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
H00004154-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for Muscleblind-like 1 Antibody (H00004154-M02)(2)

Reviews for Muscleblind-like 1 Antibody (H00004154-M02) (0)

There are no reviews for Muscleblind-like 1 Antibody (H00004154-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Muscleblind-like 1 Antibody (H00004154-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Muscleblind-like 1 Products

Bioinformatics Tool for Muscleblind-like 1 Antibody (H00004154-M02)

Discover related pathways, diseases and genes to Muscleblind-like 1 Antibody (H00004154-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscleblind-like 1 Antibody (H00004154-M02)

Discover more about diseases related to Muscleblind-like 1 Antibody (H00004154-M02).
 

Pathways for Muscleblind-like 1 Antibody (H00004154-M02)

View related products by pathway.

PTMs for Muscleblind-like 1 Antibody (H00004154-M02)

Learn more about PTMs related to Muscleblind-like 1 Antibody (H00004154-M02).

Blogs on Muscleblind-like 1

There are no specific blogs for Muscleblind-like 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Muscleblind-like 1 Antibody (3E7) and receive a gift card or discount.

Bioinformatics

Gene Symbol MBNL1
Entrez
OMIM
Uniprot