Home » PUM3 » PUM3 Antibodies » PUM3 Antibody

PUM3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: KIAA0020 Antibody [NBP1-57531] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Western Blot: KIAA0020 Antibody [NBP1-57531] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry: KIAA0020 Antibody [NBP1-57531] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-57531] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PUM3 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIAA0020 (KIAA0020) The peptide sequence was selected from the N terminal of KIAA0020. Peptide sequence GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0020
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KIAA0020 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PUM3 Antibody

  • HBV X-transactivated gene 5 protein
  • HLA-HA8MGC8749
  • KIAA0020 protein
  • KIAA0020
  • Minor histocompatibility antigen HA-8
  • PEN
  • penguin homolog
  • protein 5 transactivated by hepatitis B virus X antigen (HBxAg)
  • PUF6
  • XTP5HBV XAg-transactivated protein 5

Background

KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DMPK Antibody
(713931)
MAB6967
Western blot shows lysates of human heart tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human DMPK Monoclonal Antibody (Catalog # MAB6967) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for DMPK at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Muscleblind-like 1
Antibody (3E7)
H00004154-M02
Western Blot: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - MBNL1 monoclonal antibody (M02), clone 3E7 Analysis of MBNL1 expression in Hela S3 NE.
ELISA: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Detection limit for recombinant GST tagged MBNL1 is approximately 3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on HeLa cell. Antibody concentration 10 ug/ml.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Human liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunofluorescence analysis of rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MMP-12 Antibody
NBP1-31225
Immunohistochemistry-Paraffin: MMP-12 Antibody [NBP1-31225] - Human lung adenocarcinoma. MMP12 antibody [N3C1], Internal diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: MMP-12 Antibody [NBP1-31225] - Whole cell extract (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with MMP12 antibody [N3C1], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MMP-12 Antibody [NBP1-31225] - Analysis of methanol-fixed H1299, using antibody at 1:500 dilution.
(2 Reviews)
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
ARSH GST (N-Term) Pro ...
H00347527-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
GRB2 Antibody
(9K6H0)
NBP3-15638
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Immunohistochemistry of paraffin-embedded rat spleen using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Immunohistochemistry of paraffin-embedded human lung cancer using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Immunohistochemistry of paraffin-embedded mouse spleen using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(199 Publications)
Species: Hu
Applications: BA
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded mouse heart using Adenine Nucleotide Translocator 2 .
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Haptoglobin [HRP]
DHAPG0
(6 Publications)
Species: Hu
Applications: ELISA
NCOA6 Antibody
NB200-335
Western Blot: NCOA6 Antibody [NB200-335] - Detection of Human ASC2 by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-ASC2 antibody NB200-335 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: NCOA6 Antibody [NB200-335] - FFPE section of human colon carcinoma. Antibody: Affinity purified rabbit anti-ASC2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: NCOA6 Antibody [NB200-335] - Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-ASC2 antibody used for IP at 6 ug per reaction. ASC2 was also immunoprecipitated by a previous lot of this antibody and rabbit anti-ASC2 antibody. For blotting immunoprecipitated ASC2, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(7 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
TEF1 Antibody
NBP2-94035
Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of MCF7 cells using TEF1 .
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
GRIP1 Antibody -
BSA Free
NBP2-41211
Western Blot: GRIP1 Antibody [NBP2-41211] - Analysis of GRIP1 in 293 cell lysate with GRIP1 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunofluorescence: GRIP1 Antibody [NBP2-41211] - Immunofluorescence of GRIP1 in rat brain tissue with GRIP1 antibody at 20 ug/ml.
Immunohistochemistry: GRIP1 Antibody [NBP2-41211] - Immunohistochemistry of GRIP1 in rat brain tissue with GRIP1 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
PIAS2 Antibody
NBP1-52022
Western Blot: PIAS2 Antibody [NBP1-52022] - Western blot analysis of PIAS2 (aa185-196) in Human Peripheral Lymphocytes lysate (35ug protein in RIPA buffer) using NBP1-52022 at 1ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
Western Blot: PIAS2 Antibody [NBP1-52022] - WB analysis of PIAS2 using anti-PIAS2 antibody on Jurkat cell lyste (30 ug cell lysate boiled in lysis buffer). Image from verified customer review.
(1 Review)
(1 Publication)
Species: Hu
Applications: PEP-ELISA, WB
NCKIPSD Antibody
NBP1-42664
NCKIPSD Antibody [NBP1-42664] - Detection of human SPIN90 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-SPIN90 antibody NBP1-42664 (lot NBP1-42664-2) used for IP at 6 ug per reaction. SPIN90 was also immunoprecipitated by a previous lot of this antibody NBP1-42664-1. For blotting immunoprecipitated SPIN90, NBP1-42664 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry: NCKIPSD Antibody [NBP1-42664] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- SPIN90 used at a dilution of 1:500 (0.4ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Western Blot: NCKIPSD Antibody [NBP1-42664] - Detection of Human SPIN90 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-SPIN90 antibody NBP1-42664 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Species: Hu
Applications: IHC, IP, WB
GilZ Antibody (3A5)
H00001831-M01
Immunohistochemistry-Paraffin: GilZ Antibody (3A5) [H00001831-M01] - Human lymph node. Antigen retrieval in citrate buffer at 95C for 30 min. Image from verified customer review.
Western Blot: GilZ Antibody (3A5) [H00001831-M01] - Analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody (M01), clone 3A5.Lane 1: TSC22D3 transfected lysate(22.2 KDa).Lane 2: Non-transfected lysate.
ELISA: GilZ Antibody (3A5) [H00001831-M01] - Detection limit for recombinant GST tagged TSC22D3 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for PUM3 Antibody (NBP1-57531) (0)

There are no publications for PUM3 Antibody (NBP1-57531).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUM3 Antibody (NBP1-57531) (0)

There are no reviews for PUM3 Antibody (NBP1-57531). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PUM3 Antibody (NBP1-57531) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PUM3 Products

Bioinformatics Tool for PUM3 Antibody (NBP1-57531)

Discover related pathways, diseases and genes to PUM3 Antibody (NBP1-57531). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUM3 Antibody (NBP1-57531)

Discover more about diseases related to PUM3 Antibody (NBP1-57531).
 

Pathways for PUM3 Antibody (NBP1-57531)

View related products by pathway.

PTMs for PUM3 Antibody (NBP1-57531)

Learn more about PTMs related to PUM3 Antibody (NBP1-57531).

Blogs on PUM3

There are no specific blogs for PUM3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PUM3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KIAA0020
Uniprot