PUM3 Antibody

Images

 
Western Blot: KIAA0020 Antibody [NBP1-57531] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry: KIAA0020 Antibody [NBP1-57531] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-57531] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PUM3 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIAA0020 (KIAA0020) The peptide sequence was selected from the N terminal of KIAA0020. Peptide sequence GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0020
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KIAA0020 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PUM3 Antibody

  • HBV X-transactivated gene 5 protein
  • HLA-HA8MGC8749
  • KIAA0020 protein
  • KIAA0020
  • Minor histocompatibility antigen HA-8
  • PEN
  • penguin homolog
  • protein 5 transactivated by hepatitis B virus X antigen (HBxAg)
  • PUF6
  • XTP5HBV XAg-transactivated protein 5

Background

KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB6967
Species: Hu
Applications: WB
H00004154-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31225
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-15638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
291-G1
Species: Hu
Applications: BA
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
DHAPG0
Species: Hu
Applications: ELISA
NB200-335
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-52022
Species: Hu
Applications: PEP-ELISA, WB
NBP1-42664
Species: Hu
Applications: IHC, IP, WB
H00001831-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for PUM3 Antibody (NBP1-57531) (0)

There are no publications for PUM3 Antibody (NBP1-57531).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUM3 Antibody (NBP1-57531) (0)

There are no reviews for PUM3 Antibody (NBP1-57531). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PUM3 Antibody (NBP1-57531) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PUM3 Products

Bioinformatics Tool for PUM3 Antibody (NBP1-57531)

Discover related pathways, diseases and genes to PUM3 Antibody (NBP1-57531). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUM3 Antibody (NBP1-57531)

Discover more about diseases related to PUM3 Antibody (NBP1-57531).
 

Pathways for PUM3 Antibody (NBP1-57531)

View related products by pathway.

PTMs for PUM3 Antibody (NBP1-57531)

Learn more about PTMs related to PUM3 Antibody (NBP1-57531).

Blogs on PUM3

There are no specific blogs for PUM3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PUM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0020
Uniprot