Ghrelin/Obestatin Antibody


Western Blot: Ghrelin/Obestatin Antibody [NBP1-89773] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more
Immunohistochemistry-Paraffin: Ghrelin/Obestatin Antibody [NBP1-89773] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Ghrelin/Obestatin Antibody [NBP1-89773] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells and extracellular material in glandular lumina.
Immunohistochemistry-Paraffin: Ghrelin/Obestatin Antibody [NBP1-89773] - Staining in human stomach and liver tissues using anti-GHRL antibody. Corresponding GHRL RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Ghrelin/Obestatin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS
Specificity of human Ghrelin/Obestatin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ghrelin/Obestatin Protein (NBP1-89773PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Ghrelin/Obestatin Antibody

  • appetite-regulating hormone
  • ghrelin
  • ghrelin/obestatin preprohormone
  • ghrelin/obestatin prepropeptide
  • Ghrelin/Obestatin
  • Growth hormone secretagogue
  • Growth hormone-releasing peptide
  • Motilin-related peptide
  • MTLRPgrowth hormone secretagogue receptor ligand
  • obestatin
  • Protein M46


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ghrelin/Obestatin Antibody (NBP1-89773) (0)

There are no publications for Ghrelin/Obestatin Antibody (NBP1-89773).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ghrelin/Obestatin Antibody (NBP1-89773) (0)

There are no reviews for Ghrelin/Obestatin Antibody (NBP1-89773). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ghrelin/Obestatin Antibody (NBP1-89773) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Ghrelin/Obestatin Products

Bioinformatics Tool for Ghrelin/Obestatin Antibody (NBP1-89773)

Discover related pathways, diseases and genes to Ghrelin/Obestatin Antibody (NBP1-89773). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ghrelin/Obestatin Antibody (NBP1-89773)

Discover more about diseases related to Ghrelin/Obestatin Antibody (NBP1-89773).

Pathways for Ghrelin/Obestatin Antibody (NBP1-89773)

View related products by pathway.

PTMs for Ghrelin/Obestatin Antibody (NBP1-89773)

Learn more about PTMs related to Ghrelin/Obestatin Antibody (NBP1-89773).

Blogs on Ghrelin/Obestatin

There are no specific blogs for Ghrelin/Obestatin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ghrelin/Obestatin Antibody and receive a gift card or discount.


Gene Symbol GHRL