Ghrelin/Obestatin Antibody - BSA Free

Analysis in human stomach and liver tissues using NBP1-89773 antibody. Corresponding GHRL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Ghrelin/Obestatin Antibody [NBP1-89773] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Ghrelin/Obestatin Antibody [NBP1-89773] - Staining of human colon shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Ghrelin/Obestatin Antibody [NBP1-89773] - Staining of human duodenum shows weak cytoplasmic positivity in glandular cells.

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and GHRL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ghrelin/Obestatin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ghrelin/Obestatin Antibody - BSA Free (NBP1-89773) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GHRL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ghrelin/Obestatin Protein (NBP1-89773PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ghrelin/Obestatin Antibody - BSA Free

• appetite-regulating hormone
• ghrelin
• ghrelin/obestatin preprohormone
• ghrelin/obestatin prepropeptide
• Ghrelin/Obestatin
• Growth hormone secretagogue
• Growth hormone-releasing peptide
• Motilin-related peptide
• MTLRPgrowth hormone secretagogue receptor ligand
• obestatin
• Protein M46

Background

Ghrelin is a 28 residue pepetide expressed by stomach cells that is responsible for the hunger sensation. Expression is increased during times of fasting, and decreased after food consumption. Ghrelin is initially derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Ghrelin antibodies are useful tools for lipid and metabolism research as well as neuroscience studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GHRL