Ghrelin/Obestatin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GHRL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Ghrelin/Obestatin Antibody - BSA Free
Background
Ghrelin is a 28 residue pepetide expressed by stomach cells that is responsible for the hunger sensation. Expression is increased during times of fasting, and decreased after food consumption. Ghrelin is initially derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Ghrelin antibodies are useful tools for lipid and metabolism research as well as neuroscience studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: WB, IHC
Publications for Ghrelin/Obestatin Antibody (NBP1-89773) (0)
There are no publications for Ghrelin/Obestatin Antibody (NBP1-89773).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ghrelin/Obestatin Antibody (NBP1-89773) (0)
There are no reviews for Ghrelin/Obestatin Antibody (NBP1-89773).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ghrelin/Obestatin Antibody (NBP1-89773) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ghrelin/Obestatin Products
Research Areas for Ghrelin/Obestatin Antibody (NBP1-89773)
Find related products by research area.
|
Blogs on Ghrelin/Obestatin